close all open/close all

CDS information : Lasal2_00090


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction9,094 / 9,519 / + [in whole cluster]
9,094 / 9,519 / + [in contig]
Location9094..9519 [in whole cluster]
9094..9519 [in contig]
TypeCDS
Length426 bp (141 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acyltransferase(fragment)
Product (GenBank)
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF09; 3-oxoacyl-(acyl-carrier-protein) synthase III, fragment
Reference
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)
Related Reference
ACC
B6ZK56
NITE
Lasal_00050
PmId
[19129623] Identification of a gene cluster of polyether antibiotic lasalocid from Streptomyces lasaliensis. (Biosci Biotechnol Biochem. , 2009)
ACC
P68795
PmId
[11959561] Purification, characterization, and identification of novel inhibitors of the beta-ketoacyl-acyl carrier protein synthase III (FabH) from Staphylococcus aureus. (Antimicrob Agents Chemother. , 2002)

close this sectionSequence

selected fasta
>putative acyltransferase(fragment)
VPAGGSRRPASQETLASGEHYFHMQGRAVRDFVTTELPAGVRRLLTVCDIAPDAVDHFVP
HQANGMMLREVLPLLGLPRARTHLTVAEHANTGAASVPLALDTVRRGGLLEDGDTVLLAG
FGGGMSLGTALVRWDGAPGDG
selected fasta
>putative acyltransferase(fragment)
GTTCCCGCGGGGGGCAGCCGCAGGCCGGCGTCGCAGGAGACACTCGCCTCGGGCGAGCAC
TACTTCCACATGCAGGGGCGCGCCGTACGCGATTTCGTCACGACCGAACTCCCGGCAGGC
GTACGTCGGTTGCTCACCGTCTGCGACATCGCCCCGGACGCGGTGGACCACTTCGTCCCG
CACCAGGCCAACGGCATGATGCTGCGGGAGGTCCTGCCCCTGCTGGGACTGCCGCGGGCA
CGCACCCACCTCACGGTGGCCGAGCATGCCAACACTGGTGCGGCGTCCGTGCCGTTGGCG
CTGGACACGGTCCGGCGCGGGGGCCTCTTGGAGGACGGGGACACGGTGCTGCTCGCCGGG
TTCGGCGGAGGAATGTCCCTCGGCACCGCGCTGGTGCGCTGGGACGGGGCGCCCGGGGAC
GGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [49-134]  5.6e-28 PF08541
PF08541   ACP_syn_III_C
IPR016038 Thiolase-like, subgroup (Domain)
 [5-134]  1.3e-32 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [2-134]  1e-34 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit