close all open/close all

CDS information : Lasal2_00100


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction10,287 / 9,538 / - [in whole cluster]
10,287 / 9,538 / - [in contig]
Locationcomplement(9538..10287) [in whole cluster]
complement(9538..10287) [in contig]
TypeCDS
Length750 bp (249 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)thioesterase
Gene
Gene (GenBank)las1
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
Reference
ACC
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)
Related Reference
ACC
B6ZK57
NITE
Lasal_00060
PmId
[19129623] Identification of a gene cluster of polyether antibiotic lasalocid from Streptomyces lasaliensis. (Biosci Biotechnol Biochem. , 2009)
ACC
Q7BUF9
NITE
Rifam_00540
PmId
[19103602] Structure and functional analysis of RifR, the type II thioesterase from the rifamycin biosynthetic pathway. (J Biol Chem. , 2009)

close this sectionSequence

selected fasta
>putative type II thioesterase [thioesterase]
MSTSVGSGTWIRQYRTAGPGAPRLVCFPHAGGSASFYFPVATALSPDVDVLAVQYPGRQD
RMGEQPLTDLRRLADQVAEALEPWRDQPLHLFGHSMGAVIAYEVALRLQQSPGPGPAALY
VSGRRAPSTRRTETVHLRDDAGLIRELKTLAGTDAALLADDDVLAMILPALRADYRAIET
YEHRPAPLLTCPVTALLGDADPKVTLAEAEVWREHTDEDFDLHVFPGGHFYLTTHQPAVL
TLLRERLKA
selected fasta
>putative type II thioesterase [thioesterase]
TTGAGTACATCGGTGGGCAGCGGTACGTGGATACGGCAGTACCGCACGGCCGGGCCGGGG
GCGCCCCGTCTGGTGTGCTTCCCGCACGCCGGAGGCTCGGCCAGCTTCTACTTCCCCGTG
GCCACCGCGCTCAGCCCGGACGTCGACGTCCTCGCGGTGCAGTACCCCGGCCGGCAGGAC
CGCATGGGGGAGCAGCCGCTCACGGACCTGCGGCGCCTCGCCGACCAGGTCGCCGAGGCA
CTCGAGCCCTGGCGCGACCAGCCCCTGCACCTCTTCGGACACAGCATGGGCGCCGTCATC
GCCTACGAGGTCGCCCTGCGTCTCCAGCAGTCCCCGGGTCCCGGCCCGGCCGCGCTCTAC
GTGTCCGGCCGGCGCGCCCCCTCCACCCGGCGCACCGAGACCGTGCACCTGAGGGACGAC
GCCGGTCTGATCCGTGAGCTGAAGACACTCGCCGGGACGGACGCGGCCCTGCTCGCCGAC
GACGACGTCCTCGCCATGATCCTGCCGGCGCTGCGCGCCGACTACCGGGCGATCGAGACG
TACGAGCACCGCCCGGCGCCCCTGCTCACCTGCCCGGTGACCGCCCTGCTGGGCGACGCC
GACCCCAAGGTCACGCTCGCCGAGGCCGAGGTGTGGCGGGAGCACACCGACGAGGACTTC
GACCTGCACGTGTTCCCGGGCGGCCACTTCTACCTGACGACCCACCAGCCGGCCGTGCTG
ACCCTGCTCCGGGAGCGTCTGAAGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [23-244]  1.9e-62 PF00975
PF00975   Thioesterase
SignalP No significant hit
TMHMM No significant hit