close all open/close all

CDS information : Lasal2_00120


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction12,178 / 12,663 / + [in whole cluster]
12,178 / 12,663 / + [in contig]
Location12178..12663 [in whole cluster]
12178..12663 [in contig]
TypeCDS
Length486 bp (161 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative transcriptional regulator
Gene
Gene (GenBank)las3
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)
Related Reference
ACC
B6ZK59
NITE
Lasal_00080
PmId
[19129623] Identification of a gene cluster of polyether antibiotic lasalocid from Streptomyces lasaliensis. (Biosci Biotechnol Biochem. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [putative transcriptional regulator]
MTEKPTQARDQEAVLKFIERFAAALTEAGFPRMPARVFVALFASDSDHLTAGELAEQLQV
SPAAISGAVRYLTQVNLAIREREPGARQDHFRVDGNVWYELMRRRDRELVRWEDSLREGV
ETLGRDTPAGAKLAATLPFFEFMQKELSEMLERWRQQEGNS
selected fasta
>hypothetical protein [putative transcriptional regulator]
GTGACCGAGAAGCCGACGCAGGCCCGGGACCAGGAGGCCGTGCTCAAGTTCATCGAGCGC
TTCGCGGCCGCGCTCACCGAGGCGGGCTTCCCGCGGATGCCCGCCCGGGTCTTCGTCGCC
CTGTTCGCCTCGGACTCCGATCACCTGACCGCCGGCGAGCTCGCCGAGCAGCTCCAGGTG
AGCCCCGCGGCCATCTCGGGCGCCGTGCGGTACCTGACGCAGGTGAACCTGGCCATCCGG
GAGCGTGAACCGGGCGCCCGCCAGGACCACTTCCGGGTGGACGGCAACGTCTGGTACGAG
CTCATGCGCCGCCGTGACCGCGAACTCGTCCGCTGGGAGGACAGCCTGCGCGAGGGTGTC
GAGACCCTCGGCAGGGACACCCCCGCCGGGGCGAAGCTCGCGGCGACACTGCCCTTCTTC
GAGTTCATGCAGAAGGAGTTGTCGGAAATGCTGGAGCGCTGGCGTCAGCAGGAGGGAAAT
TCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [14-91]  5e-12 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit