close all open/close all

CDS information : Lasal2_00130


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction13,216 / 15,954 / + [in whole cluster]
13,216 / 15,954 / + [in contig]
Location13216..15954 [in whole cluster]
13216..15954 [in contig]
TypeCDS
Length2,739 bp (912 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)LuxR-family transcriptional regulator
Gene
Gene (GenBank)las4
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)
Related Reference
ACC
B6ZK61
NITE
Lasal_00100
PmId
[19129623] Identification of a gene cluster of polyether antibiotic lasalocid from Streptomyces lasaliensis. (Biosci Biotechnol Biochem. , 2009)
ACC
Q9S0N8
NITE
Aver_00010
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[19148632] Characterization of a regulatory gene, aveR, for the biosynthesis of avermectin in Streptomyces avermitilis. (Appl Microbiol Biotechnol. , 2009)
[20012992] The pathway-specific regulator AveR from Streptomyces avermitilis positively regulates avermectin production while it negatively affects oligomycin biosynthesis. (Mol Genet Genomics. , 2010)

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [LuxR-family transcriptional regulator]
MPFSVMESVEQQTEWRTLHTAFDDAASGISRTVLIEAGVACGKSTVLEGIGDYTAARGAL
VLHAVGSLSGSGTPLGVVRQLVEYPSFPATAGQNLLADVERGDYAQFSAALRNIAVRLPV
VVSVDDLHHVDAASLHCLLHLVGHTRRSRILTLFTQSLSCAPQDPTFDTELLRQPNFRRV
RLAPLDLHGVTAMLANHPEVDAGEDLTRELHSVSGGNPLLLRALIEDHLAARRFAGPSGE
RAEPGVAFSRAVLTCLHRGGSRMRDAATALAVLGESEHTALLGPLAGLSAAALAQARHAL
DATGITAEHRFRHRLARAAVLDSITPADRRALHLKAATLLHRHGASVREVAAHLLAGGGT
PDAWGVTALKEAAEEALAADRAQEAVAFLELAHAGSTDARTRAEITVRLACVMWRLNPAT
AESLYLAESLSALWSGLLPVPFIAPLANLLVAHGRLDEARHVLGRLQESTGPGQALPADT
EIMHPWEWDVHFPHALAPATPATSGRDIRLLSSHGGRPDPVHATGIERFLRVSPLTDTTL
TAVTTAIKSLIHHDRVDLAESWCDAFLQEAERRDAPGWEVLFASLRAEIALHQGRLTDAE
QYADRALAAVPEHTGVFFIGGPLSSLVLAYTAMGDYESAARRLNQSVPEALFKNVYGLRY
LRARGRYYLATNRAHTALGDFLDAGRLAARWGVDRPTLLPWRSDAAEAWLELGNPEQAER
LITDQLQMRDAINSRVRGISLRLRAMTADAKVRPRLLTKAVEALQTSGDRLEMARVLDAL
GDAQQALGDTTRAAAAKRRARHMARECGATAWGGAPQSTASRSVPASRRHWSAEGHAPSA
LTKLSESEKRVAALAACGYTNRDISAKLYITVSTVEQHLTRVYRKLHISRREQLPPDLQF
SPYENDCQSIAT
selected fasta
>putative LuxR family transcriptional regulator [LuxR-family transcriptional regulator]
GTGCCCTTCTCTGTCATGGAATCCGTTGAACAGCAAACAGAATGGCGTACGCTTCACACA
GCATTCGACGACGCGGCGTCCGGAATATCCCGGACGGTACTGATAGAAGCCGGAGTCGCC
TGCGGGAAAAGCACGGTTCTGGAGGGAATCGGCGACTACACCGCGGCCCGGGGCGCCTTG
GTCCTGCACGCCGTGGGCTCGTTGTCCGGCAGCGGAACACCGCTCGGCGTCGTACGCCAA
CTCGTCGAATACCCTTCATTCCCCGCAACCGCCGGCCAAAACCTCCTCGCGGACGTGGAA
AGGGGAGATTACGCACAGTTCTCCGCAGCGCTGCGGAATATAGCCGTCCGCTTACCGGTG
GTGGTGAGCGTAGACGACCTGCACCACGTGGACGCCGCCTCCTTGCACTGCCTCCTCCAC
CTCGTCGGCCACACCCGCCGGAGCAGGATTCTCACCCTGTTCACCCAGTCGTTGTCGTGC
GCTCCCCAAGACCCCACGTTCGACACCGAATTGCTGCGCCAGCCCAATTTCCGCAGGGTC
CGGCTCGCCCCGCTCGACCTGCACGGCGTGACCGCGATGCTCGCGAACCACCCCGAGGTC
GACGCCGGCGAGGACCTGACGCGGGAACTGCACTCCGTCAGCGGGGGGAACCCGCTGCTG
CTGCGCGCGCTGATCGAGGACCACCTGGCGGCCCGCCGCTTCGCGGGTCCGTCGGGTGAA
CGCGCCGAGCCCGGCGTCGCGTTCAGCCGGGCCGTGCTCACCTGTCTGCACCGGGGCGGC
AGCCGCATGCGTGACGCCGCCACCGCCCTGGCCGTTCTGGGCGAGTCCGAGCACACCGCC
CTGCTGGGCCCCCTTGCGGGCCTGTCGGCGGCGGCGCTCGCCCAGGCCCGGCACGCCCTC
GACGCCACCGGCATCACCGCGGAGCACCGCTTCCGCCACCGCCTGGCCAGAGCCGCCGTG
CTGGACAGCATCACCCCCGCGGACCGGCGCGCCCTGCACCTGAAGGCCGCGACCCTGTTG
CACCGGCACGGCGCCTCCGTCCGCGAGGTCGCCGCCCACCTGCTCGCCGGCGGCGGCACG
CCGGACGCCTGGGGAGTCACCGCACTCAAGGAGGCGGCCGAGGAGGCACTCGCCGCCGAC
CGGGCACAGGAGGCGGTCGCCTTCCTGGAGCTGGCCCACGCCGGTTCCACCGACGCCCGT
ACCCGGGCGGAGATCACCGTCCGGCTCGCCTGCGTCATGTGGCGCCTCAACCCGGCCACC
GCGGAGAGCCTGTACCTGGCGGAGTCCCTCTCCGCCCTGTGGTCCGGGCTGCTGCCGGTG
CCCTTCATCGCGCCGCTGGCCAACCTGCTCGTCGCCCACGGCCGCCTCGATGAGGCACGT
CACGTCCTCGGCCGGCTGCAGGAGTCGACCGGTCCCGGCCAGGCCCTGCCGGCGGACACC
GAGATCATGCACCCCTGGGAGTGGGACGTGCACTTCCCCCACGCCCTGGCGCCGGCCACT
CCGGCGACGTCCGGCCGGGACATCCGTCTGCTGAGCTCGCACGGCGGCCGGCCCGATCCC
GTCCACGCCACGGGGATCGAGCGGTTCCTGCGGGTGTCGCCGCTGACCGACACCACCCTC
ACCGCCGTCACCACGGCGATCAAGTCGCTCATCCACCACGACCGCGTGGACCTGGCCGAG
AGCTGGTGCGACGCCTTCCTGCAGGAGGCCGAGCGGCGCGACGCCCCCGGTTGGGAGGTG
CTGTTCGCCTCCCTGCGCGCCGAGATCGCGCTGCACCAGGGCCGGCTCACCGACGCCGAA
CAGTACGCCGACCGCGCGCTGGCGGCCGTCCCGGAGCACACCGGGGTGTTCTTCATCGGC
GGTCCCCTGTCCAGCCTGGTGCTGGCGTACACCGCGATGGGCGACTACGAGTCCGCGGCC
CGACGGCTCAACCAGTCGGTGCCCGAAGCGCTGTTCAAGAACGTGTACGGACTGCGCTAC
CTGCGCGCCCGGGGACGCTACTACCTGGCCACCAACCGGGCGCACACCGCCCTGGGCGAC
TTCCTCGACGCCGGCCGGCTCGCCGCGCGCTGGGGCGTCGACCGTCCCACGCTGCTGCCG
TGGCGCTCGGACGCCGCCGAGGCCTGGCTCGAACTGGGCAACCCGGAACAGGCCGAGCGG
CTGATCACCGACCAGCTCCAGATGCGCGACGCGATCAACTCCCGGGTGCGGGGCATCTCG
CTGCGGCTACGCGCGATGACCGCGGACGCCAAGGTGCGCCCACGACTGCTCACCAAGGCG
GTGGAAGCCCTGCAGACGTCCGGGGACCGGCTGGAGATGGCCCGCGTCCTGGACGCCCTG
GGCGACGCGCAGCAGGCCCTGGGCGACACCACCCGGGCCGCCGCGGCCAAGCGCCGGGCC
CGCCACATGGCCCGCGAGTGCGGAGCCACGGCGTGGGGCGGCGCTCCGCAGTCCACCGCC
TCCCGGTCTGTGCCGGCCTCACGGCGGCACTGGTCGGCCGAGGGACACGCGCCGTCCGCC
CTCACCAAGCTCAGCGAGTCGGAGAAGCGGGTGGCCGCCCTGGCCGCCTGCGGATACACC
AACCGCGACATATCGGCCAAGCTGTACATCACCGTCAGCACGGTCGAGCAGCACCTCACC
CGGGTCTACCGGAAGCTGCACATCTCACGCCGTGAACAGCTGCCGCCCGACCTCCAGTTC
AGCCCGTACGAGAACGACTGCCAGTCCATCGCCACGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [843-894]  4.5e-09 PF00196
PF00196   GerE
 [844-858]  4.69999810630989e-08 PR00038 [858-874]  4.69999810630989e-08 PR00038 [874-886]  4.69999810630989e-08 PR00038
PR00038   HTHLUXR
 [858-885]  PS00622
PS00622   HTH_LUXR_1
 [841-898]  5.59999989417023e-19 SM00421
SM00421   HTH_LUXR
IPR011990 Tetratricopeptide-like helical (Domain)
 [549-852]  1.4e-17 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [853-894]  5e-16 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [822-894]  1e-13 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit