close all open/close all

CDS information : Lasal2_00150


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction19,180 / 17,453 / - [in whole cluster]
19,180 / 17,453 / - [in contig]
Locationcomplement(17453..19180) [in whole cluster]
complement(17453..19180) [in contig]
TypeCDS
Length1,728 bp (575 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative 3-hydroxyacyl-CoA dehydrogenase
putative beta-keto-reductase
Product (GenBank)3-hydroxyacyl-CoA dehydrogenase
Gene
Gene (GenBank)las6
EC number1.1.1.35
Keyword
  • ethylmalonyl-CoA
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)
Related Reference
ACC
B6ZK63
NITE
Lasal_00120
PmId
[19129623] Identification of a gene cluster of polyether antibiotic lasalocid from Streptomyces lasaliensis. (Biosci Biotechnol Biochem. , 2009)
ACC
P52041
PmId
[8655474] Cloning, sequencing, and expression of clustered genes encoding beta-hydroxybutyryl-coenzyme A (CoA) dehydrogenase, crotonase, and butyryl-CoA dehydrogenase from Clostridium acetobutylicum ATCC 824. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>putative 3-hydroxyacyl-CoA dehydrogenase [3-hydroxyacyl-CoA dehydrogenase]
MGMAQQRFPTVAVVGLGITGSALMTLLARTGHRVVAVDVDEAALERARDRARAAGVEGVD
FTTRFADVARADLLVEAVPEQLEAKRQVLRRAHEVCPGATVFATTTTSLSVTGLAFESGR
MASTIGLHFFPTAPEDGLGAVELIATPVTARALLDDVRELLHGLGSTAVSSTDSPGFVGG
ALTMSYLNGAAAMYEQRYAAEEGIDAAMTLGCGVPLGPLAQLDAMGLDTAHDTLEALYQR
TGDRGYAPAPVLTHMVAAGLLGVKSGRGFHDYAGGRAAGDARTGAQAAVPRTVRTIGVVG
SGVMATGIAEVCARSGHPTTLVARSGVKAKEALAAVGRSLERQVRRGRRTPEELAATTAR
LSGASAYEALADCDLVVEAVAEDLAVKRGVFGALDRVCRPGAVLATSTSSLPVVECATAT
GRPQDVLGMHFFNPAPVMKLVEVVRTVLTAQDTVSTALAAAAALGKRPVQCADRAGFIVN
ALLFPYLNRAVCMMREGVATADEIDTVMTAGHGFPMGPFKLLDVIGLDVSLAIQKTLHRA
FREPALAPARPLEQLVEAGYLGRKAGRGFRSYDTV
selected fasta
>putative 3-hydroxyacyl-CoA dehydrogenase [3-hydroxyacyl-CoA dehydrogenase]
ATGGGCATGGCACAGCAGCGTTTCCCGACGGTTGCGGTCGTCGGGCTCGGCATAACGGGT
TCCGCCCTCATGACATTACTGGCCCGTACCGGACACCGGGTGGTCGCGGTCGACGTGGAC
GAGGCGGCTCTGGAGCGCGCCCGGGACCGGGCTCGCGCGGCGGGAGTGGAGGGTGTCGAC
TTCACCACGCGGTTCGCCGACGTCGCCCGGGCCGATCTTCTCGTCGAGGCGGTGCCCGAA
CAGCTGGAGGCCAAGCGGCAGGTCCTGCGCCGCGCCCACGAAGTGTGCCCGGGCGCCACC
GTGTTCGCGACCACCACGACGTCCCTGTCGGTGACCGGTCTCGCCTTCGAGTCCGGGCGG
ATGGCGAGCACGATCGGCCTGCACTTCTTTCCCACGGCCCCTGAAGACGGCCTCGGAGCC
GTGGAGTTGATCGCCACCCCGGTCACGGCCCGGGCGCTGCTGGACGACGTCCGCGAGCTG
CTGCACGGCCTCGGCAGCACCGCCGTGTCCAGCACCGACAGCCCCGGTTTCGTCGGCGGC
GCCCTGACGATGTCGTACCTGAACGGCGCCGCCGCCATGTACGAGCAGCGCTACGCCGCC
GAGGAGGGCATCGACGCCGCGATGACCCTGGGCTGCGGCGTGCCCCTCGGCCCGCTCGCG
CAGCTCGACGCGATGGGCCTGGACACCGCCCACGACACCCTGGAAGCGCTCTACCAGCGC
ACCGGGGACCGCGGTTACGCCCCGGCCCCCGTGCTGACGCACATGGTGGCCGCCGGGCTG
CTCGGCGTGAAGTCGGGGCGCGGCTTCCACGACTACGCGGGCGGACGGGCGGCCGGCGAC
GCCCGCACAGGAGCGCAGGCGGCCGTGCCGCGCACCGTCCGCACCATCGGCGTGGTCGGC
TCCGGCGTCATGGCCACCGGCATCGCCGAGGTGTGCGCGCGCTCCGGACACCCCACCACG
CTGGTCGCCCGCAGCGGGGTGAAGGCGAAGGAGGCCCTGGCCGCGGTCGGGCGCTCACTG
GAGCGGCAGGTCCGCCGCGGCAGGCGGACCCCCGAGGAACTCGCCGCGACCACCGCCCGG
CTCAGCGGCGCGTCGGCCTACGAGGCGCTTGCCGACTGCGACCTCGTGGTGGAGGCCGTC
GCCGAGGACCTCGCGGTCAAACGGGGGGTGTTCGGCGCACTGGACCGGGTGTGCCGGCCC
GGCGCCGTGCTCGCCACCTCCACCTCCAGCCTGCCCGTCGTCGAATGCGCCACGGCCACC
GGTCGCCCGCAGGACGTGCTGGGCATGCACTTCTTCAACCCGGCACCGGTCATGAAGCTC
GTGGAGGTCGTACGGACGGTGCTGACCGCCCAGGACACGGTGTCCACCGCCCTCGCGGCC
GCCGCCGCCCTCGGCAAGCGGCCCGTCCAGTGCGCGGACCGGGCCGGCTTCATCGTGAAC
GCCCTGCTCTTCCCTTACCTCAACCGGGCGGTGTGCATGATGCGCGAGGGGGTGGCCACC
GCCGACGAGATCGACACGGTGATGACGGCCGGCCACGGCTTCCCGATGGGCCCCTTCAAG
CTGCTGGACGTGATCGGCCTCGACGTCTCACTGGCCATCCAGAAGACCCTGCACCGCGCG
TTCCGCGAGCCGGCGCTCGCCCCTGCCCGCCCGCTGGAACAGCTGGTGGAGGCGGGTTAC
TTGGGACGCAAGGCGGGACGCGGCTTCCGCTCGTACGACACCGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006108 3-hydroxyacyl-CoA dehydrogenase, C-terminal (Domain)
 [176-272]  5.3e-23 PF00725 [476-572]  1.4e-29 PF00725
PF00725   3HCDH
IPR006176 3-hydroxyacyl-CoA dehydrogenase, NAD binding (Domain)
 [10-173]  6.5e-33 PF02737 [295-473]  5.2e-57 PF02737
PF02737   3HCDH_N
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like (Domain)
 [175-276]  4.1e-25 SSF48179 [476-573]  1.3e-29 SSF48179
SSF48179   6-phosphogluconate dehydrogenase C-terminal domain-like
IPR013328 Dehydrogenase, multihelical (Domain)
 [178-272]  3.9e-22 G3DSA:1.10.1040.10 [478-572]  4.7e-29 G3DSA:1.10.1040.10
G3DSA:1.10.1040.10   no description
IPR016040 NAD(P)-binding domain (Domain)
 [8-177]  1.1e-26 G3DSA:3.40.50.720 [290-477]  1.7e-51 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP No significant hit
TMHMM No significant hit