close all open/close all

CDS information : Lasal2_00160


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction19,470 / 34,430 / + [in whole cluster]
19,470 / 34,430 / + [in contig]
Location19470..34430 [in whole cluster]
19470..34430 [in contig]
TypeCDS
Length14,961 bp (4,986 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)lasalocid modular polyketide synthase
Gene
Gene (GenBank)lasAI
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase modules and related proteins
Reference
ACC
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)
Related Reference
ACC
B6ZK64
NITE
Lasal_00130
PmId
[19129623] Identification of a gene cluster of polyether antibiotic lasalocid from Streptomyces lasaliensis. (Biosci Biotechnol Biochem. , 2009)

close this sectionPKS/NRPS Module

0 malonyl-CoA
1 ethylmalonyl-CoA
2 malonyl-CoA
KSQ17..381
AT536..858
ACP959..1029
KS1052..1428
AT1581..1892
DH1940..2108
KR2476..2656
ACP2762..2832
KS2857..3233
AT3385..3693
DH3739..3900
ER4240..4533
KR4543..4723
ACP4832..4902

close this sectionSequence

selected fasta
>polyketide synthase [lasalocid modular polyketide synthase]
MGSAARTQENAATARHEPIAVVGLSCRFPRATGPQAYWRLLRDGVDAVTRVPERRWNVAE
DTTDPGTRFGAFLDDVSGFDPAFFGLSPREATAMDPQQRLVLELGWEALEDAGIVPADLA
ETATGVFVGAIWDDYAALTRQGGAASIGRHTATGVNRGVIANRLSYVLDLRGPSLTLDTA
QSSALVAVHEACQSILRGESTLALAGGVNLNLVPGSSLMAARFGGLSPDGRCFTFDARAN
GYVRGEGGGLVVLKPLERAVADGDTVYCVIRGGAVNNDGATEGLTVPSARAQEQVVRLAQ
ARAGVTPADVQYVELHGTGTRRGDPLEAAALGAVFQGAEAPVRVGSAKTNIGHLEGAAGI
AGLIKAALCVRHRRLVPHLNFVSPHPDIPLDTLNLRVQTALESWPRADRPLVAGVSSFGM
GGTNCHLVLSEPAPAPRPAEPGTSATPVLLLPVSGRTEPALRAQARALATAVRSEPAVRP
LDLAYGLATTRTAFEHRAVLLAADRDGVLNALDALAADEPSAQVLRGEPLHGGTAFLFSG
QGSQRARMGHELHTAFPVYAEAFDEVCALLDAHLGREVPLRDVVFAAEDSPGAALLHRTE
YTQRALFAVETALYRLLSHWGLTADFLVGHSVGELAAAHAAGVLSLDDACALVAARGRLM
GELPTGGAMIAVQATEDEVRAALAEHGTRLSLAAVNGPTAMVVSGDEDAALELAARWRAE
GRKTRRLHVSHAFHSPRMDAMLDAFRRTAARLAYHAPHTPLVSNVTGRPATADEVCSPDY
WVRHAREAVRFHDGVRTLEAAGVTTFVELGPDGVLTSMARDCVTSTDTAFVPVLRGSRPE
VRAAAGALGRLHAHGVAVDWRRFYDGCGAVRVDLPTYAFQRRPYWIDVPAAPGDPRETVP
APRDEAAGRPEPEEASAGTAEAEGVKAGTADDPGLSGRGGREAGRSTSAPKPATRERAMA
DVVRAQVATVLEHDAPGDIDLRTTFKGLGFDSLTLVELRDRLTRATGLRLTPSALFDHPT
PARLAEHLRTLVEGDAPQDTPDASAAPAPDDDPVAIVAMACRFPGGVASPDDLWRLVAEG
GDAISGFPTDRGWDMDALYDPDPTRTGKNYVREGGFLDSAADFDAAFFGISPREALAMDP
QQRLLLETSWEALERAGVAPGSLRGTRTGVFVGTTFQDYGPRLHQGTETTEGYLLTGGTP
SVASGRIAYTLGLEGPAVTVDTACSSSLVALHMACRALRAGECTMALAGGVTVMATPGMF
VELSRQRALSPDGRCKSFSSAADGTGWAEGAGVLLVERLSDARRNGHRVLAVVRGSAINQ
DGASNGLTAPNGLSQQRVIRQALADARLSGADVDVVEAHGTGTRLGDPIEADALLATYGQ
DRPADRPLRLGSVKSNIGHTQCAAGVAGVIKTVMAMRHGLLPRTLHVDEPSPHIDWTSGA
VSLLTEPVDWHVGDRPRRAGVSSFGISGTNAHVILEDVLDDQEPSSPEDDASATPLVLSA
DDPQALRAQAARLHSFVEQRPDIPLSDVRFTLLHGREALDQRAAVVGHDRADVLAALADL
AGGEAGAGVLTGGVGGVGKVVFVFPGQGSQWPGMGRELLDTSPVFATHIAECEAALTPYV
DWSLTDVLRQGEPLDRIEILQPVLFALMVSLARLWQHHGIHPDAVTGHSQGEIAAAHIAG
ALTLDDATRIVVLRSQLFADHLTGHGAIASLTLPATQVTHQLAQYDGRLTIAGINSPTTC
TVAGPHTDLTTLTHWARQQGARARIIDTTVASHSPHVEPLHDDLIHLLADISPQAGTIPI
YSTVTTEPIDGTQLTAEYWYDNCRHPVRFHDTLHTLTTHGHTHYLEISPHPVLIPAITET
HPTATTIPTLHRNQGTTTDLHTSLAHAWTTGLPTTWTRPRSGDTHIPDLPTYAFQHQRYW
LTEPTTVDDPSAYGLHATQHPLLTAALHDAETGRVTLTGRIAPRTHAWLDDHAAHGTPLL
PGTAFTELVLHAGAEVGCPYVEELTLHTPLPLAAPVQIQLVVDAPGDGGERTVRLYSRPV
RPSRPGDAADPDEPWTHHATGAVSAARGEQAAELSEWPPRGAQVLPVERFYDDAALTGYA
YGPSFRGLERAWRLGDEVYADVRLSEEQVEEAGRYAIHPALFDAAVHTALVDSVGEGASV
RLPFAWSGVALHAVGATSLRVRATRTGADSVSLDLADPAGRPVATVGSLTLLPVTSEQVR
GVSSAGHDDLYRIEWTTLTASTTVEDRPASASCAVIGRNAGPEFGASVRAYGSVAELVSA
LDAGEPVPELVLLPVTAPTGEEEVAAAARHTAERVLGVAQEWLASEHTESSRLVVVTRGA
VAVGGESGRVDLALAPVWGLLRSAQAESPGRFVLVDVEAEGGSLAAGGASVAAGEASVKA
NGGSPEADGGSQEEGSGSVVAAVAAVLATDEPQLAVRGGEVRVPRLRRATTAEADAESKS
EAKSEAEAATPWSASGTVLVTGGTGTLGGLVARHLVAEHGVRHLLLTSRRGADAPGVGAL
VADLNAAGAQVTVAACDAADRDELARVLADVPHGHPLAGVVHAAGVLDDGVIGALTPARL
ERVLRPKVDAAVNLHELTRGSDLSAFVLFSSVAGVFGNPGQANYAAANAFLDALAERRRA
EGLPGVSLAWGLWAESSGMTGHLAADDLSWMARSGIRSLPSDTGLALFDAATDGAGSGLL
VPVALDGAALRERAASGLLPHLLQGLVRTPVRQAARRGAEPDGSALATRLSGLGDAERDE
QLLTLVRSHVAAVLGHRSPQTIDAERAFKELGFDSLTAVELRNRLAAATGVRLPATLVFD
HPTLTSVVERLRTAVLGTTPTAVSRPPAVTRAATDTEPIAIVGMACRYPGDVRSPEDLWQ
MVAEGRDVIAGFPADRGWDLEGLYDPQSARPGTSYAREGGFLHDAGHFDPAFFGISPREA
LAMDPQQRLLLETSWEVFERAGLDPTALKGSRTGVFAGLMHHDYAGPGDRLPEGVEGYAL
TGTQGSVVSGRIAYVYGLEGPAVTVDTACSSSLVALHLACQSLRNGECELALAGGVAVMA
TPGVFVEFSRQRGLAADGRCKSFAAAADGTGWSEGVGLLLVERLSDARRNGHRVLAVVRG
SAVNQDGASNGLTAPNGPSQQRVIHQALANARLTPGEVDAVEAHGTGTRLGDPIEAQALL
ATYGQERAEDRPLWLGSVKSNMGHAQAAAGVAGVIKMVMAMRHGLLPRTLHVDEPTPHVD
WSTGAVSLLTEDTTWPETGRPRRAAVSSFGISGTNAHVVLEAPAPVTDEPGDGPTGTPPW
VVSGRSRTALRAQAARLVSYVQEREDLPAADVGTALLTTRAALEHRAVVLGPDRDQLLEG
LHALADEQDSPRVVTGSVRPGRLAFMFTGQGSQRLGMGHELYDTEPAFAAALEEAFAALD
PHLPRPLREIVFGDDPELLQQTQYAQPALFAVETALYRLLTDTYGLRPDYLLGHSIGELT
AAHAAGVLTLPDAARLVTARGRLMQTAPTGGTMIAIQADENEITQQLTPGVDIAALNSPS
STVISGDTAEAEAIADRCRALGRKTSRLKVSHAFHSPHMDPVLDDFRQIAATLDYHPARI
PVISNTTGQPAENLTSPDYWTQHIRRPVRFTDSLHHLTQQGVTTFLELGPDATLTALTRT
TLDDTHATAVLRKDRTDTDALRTALAELWVHGTPVTWPHPADRHIDLPTYPFDHQHYWLP
SGSGAVVDAAGLGLGATHHPVLGAAAVLADSEQHLFTGRVSLRTHPWLAHHTVGGAVLLP
GTVLVEAVLRAGDEVGCSRVEELTLEAPLVLPRHGAVQLQLLVGPPDADGSRSVQVYARP
EDDGRSTASWVRHASGSLGTGDGAEPAGHTVWPPTGAVPLPVEDFYDGHGKGYGPGFRGL
RSAWRHGEDLYAEVVMPEELSQAALSPGEFGIHPALLDIALHTVLLDDSGVRPSARLPFA
WSDVTLHATGATELRVRVSGSADDTFSVEASDPTGRPVVSIGSLVLRPVSDEQLRTADGG
GADSDALFRVDWSPFAVDGPGSQGADGDWAVITAAASELAVVLGEARDSLRTCSDLSALR
AAVGGGEPVPEAVVLPYVTPHPADGDGLPAEVHRATRQALADVQTWLADEALDDSRLVVV
TRRAVATHAGEDVGDLVHAGVWGLLRSAQSEHPGRLFLLDLDDDPASYAALPEAVASAEP
QLAVRQGAMLVPRLFRSVTDGELSPPSDADAWRLDTVRPGTPDDLELLACPDVLAPLGPG
QVRVSVHAAGLNFRDVLMALGMYPGELSLGSEGAGIVTAVGPGVSRFEVGDRVMGMLPRC
FGPFAVADQRTVVRMPEGWSFEQAAAVPAVFLTAYYGLRDLADLRAGESVLIHAAAGGVG
MAAVQLARHWGATVHATASPHKWDTLHALGLDDDHIASSRTLDFRDQFTEVDVVLNSLTG
AYIDASLHLLRNGGRFIEMGKTDIRPTPPHVSYHAFDLMEAGPQRLGDMLTDIVQLLQTG
TLTHLPLDTRDIRQAPQTFRHMSQARHTGKIVLRIPQPLDPHGTVLITGGTGTLGALTAR
HLATTHNTRHLLLTSRQGTAAPGATQLADELRDLGAHVTIAACDTADRTALTHLLDSIPA
EHPLTAVIHCAGTLDDSTVPALTPDQLDAVLRPKVDAAWHLHHLTRHLDLSAFVLFSSVA
GVIGNPGQGNYAAANTFLDALAHHRHAHGLPATSLAWGQWQQASGMTGELSEADLARLSR
AGIRPMPTDEALALLDAATGTFTEALLVPARLDLKALRAREVEGALPPLLRDLVRATGPV
RRTAATARDAAEGPSFAQRLASQSPAERRSSVLELVRTHVAAVLGHASPGAVGATSSFKE
IGFDSLSAVELRNRLGAATGQRLPSTLVFDYPTSEALAGHLLEQLAPQGPQDSVSVLGEI
DRLESALASVGTDGQDDGTITTRLELLLAKWKEAQNSAARASVADRLQAATPDEVLDFID
NELGVS
selected fasta
>polyketide synthase [lasalocid modular polyketide synthase]
GTGGGTTCCGCGGCACGCACGCAGGAGAACGCGGCGACAGCGCGGCACGAACCGATCGCC
GTGGTCGGTCTCTCCTGCCGCTTCCCCCGGGCGACCGGCCCCCAGGCGTACTGGCGGCTG
CTGCGTGACGGCGTCGACGCGGTCACCCGCGTGCCGGAGCGGCGCTGGAACGTCGCCGAG
GACACCACGGACCCGGGCACGCGCTTCGGTGCGTTCCTCGACGACGTCAGCGGCTTCGAC
CCGGCGTTCTTCGGCCTGTCGCCCCGTGAGGCGACCGCCATGGACCCGCAGCAGCGCCTG
GTGCTGGAGCTCGGCTGGGAGGCCCTGGAGGACGCCGGGATCGTGCCGGCCGACCTCGCG
GAGACCGCCACCGGCGTGTTCGTCGGCGCGATCTGGGACGACTACGCCGCCCTCACCCGC
CAGGGCGGTGCGGCGTCCATCGGCCGCCACACGGCGACCGGCGTGAACCGCGGCGTCATC
GCCAACCGCCTCTCGTACGTGCTGGACCTGCGCGGTCCGAGCCTCACCCTGGACACCGCC
CAGTCCTCCGCGCTGGTCGCCGTGCACGAGGCGTGCCAGAGCATCCTGCGCGGCGAGTCG
ACCCTCGCCCTCGCCGGCGGGGTGAACCTCAACCTGGTGCCCGGCAGCTCCCTGATGGCC
GCCCGCTTCGGCGGGCTCTCCCCCGACGGGCGCTGCTTCACCTTCGACGCGCGGGCCAAC
GGCTACGTGCGCGGCGAGGGCGGCGGCCTCGTCGTCCTGAAGCCGCTGGAGCGGGCCGTC
GCCGACGGCGACACCGTGTACTGCGTGATCCGGGGCGGCGCGGTCAACAACGACGGTGCC
ACGGAGGGGCTCACGGTGCCCAGTGCCCGGGCCCAGGAGCAGGTGGTGCGGCTGGCCCAG
GCGCGGGCCGGCGTCACCCCGGCCGACGTGCAGTACGTCGAGCTGCACGGCACCGGCACC
CGGCGCGGCGACCCCCTCGAGGCGGCCGCGCTCGGCGCGGTCTTCCAGGGCGCCGAGGCT
CCAGTACGGGTCGGCTCCGCCAAGACCAACATCGGCCACCTGGAGGGCGCCGCGGGCATC
GCCGGTCTGATCAAGGCCGCCCTGTGCGTCCGGCACCGCCGGCTGGTCCCGCACCTCAAC
TTCGTGTCCCCCCACCCCGACATCCCCCTGGACACACTCAACCTGCGGGTGCAGACCGCA
CTGGAGTCGTGGCCGCGGGCCGACCGTCCCCTGGTCGCGGGCGTCAGCTCCTTCGGCATG
GGCGGCACCAACTGCCACCTGGTGCTGTCCGAACCCGCGCCGGCCCCCCGGCCCGCGGAA
CCCGGCACCTCCGCCACCCCGGTGCTGCTGCTCCCCGTCTCCGGCCGCACCGAACCGGCG
CTGCGCGCACAGGCCCGCGCGCTGGCCACGGCGGTCCGGTCCGAGCCCGCCGTGCGGCCG
CTGGACCTCGCGTACGGGCTGGCGACGACCCGTACGGCCTTCGAGCACCGCGCGGTGCTG
CTGGCGGCCGACCGGGACGGCGTCCTCAACGCCCTCGACGCCCTGGCGGCCGACGAGCCC
TCCGCGCAGGTCCTGCGGGGTGAGCCGCTGCACGGCGGCACGGCCTTCCTGTTCTCCGGC
CAGGGCAGCCAGCGCGCCCGGATGGGACACGAACTGCACACCGCGTTCCCCGTCTACGCC
GAGGCGTTCGACGAGGTCTGCGCCCTGCTGGACGCCCACCTCGGCCGCGAAGTCCCGTTG
CGGGACGTTGTGTTCGCAGCCGAAGACTCGCCCGGGGCGGCGCTGCTGCACCGCACCGAG
TACACCCAGCGCGCGCTGTTCGCCGTCGAGACGGCCCTGTACCGGCTGCTGAGCCACTGG
GGTCTGACCGCCGACTTCCTCGTCGGCCACTCCGTCGGCGAGCTCGCGGCGGCCCACGCG
GCCGGGGTGCTGTCCCTCGACGACGCCTGTGCCCTGGTGGCGGCACGGGGCCGGCTGATG
GGCGAACTCCCCACGGGCGGCGCCATGATCGCCGTACAGGCGACCGAGGACGAGGTGCGT
GCCGCACTGGCCGAGCACGGGACGCGGCTGTCGCTCGCCGCGGTCAACGGCCCGACCGCC
ATGGTGGTCTCCGGCGACGAGGACGCGGCGCTCGAACTCGCCGCGCGCTGGCGGGCCGAG
GGCCGCAAGACCAGACGCCTCCACGTCAGCCACGCCTTCCACTCGCCCCGCATGGACGCG
ATGCTGGACGCGTTCCGGCGGACCGCGGCCCGGCTGGCGTACCACGCCCCGCACACCCCG
CTGGTCTCCAACGTCACCGGTCGCCCGGCGACCGCCGACGAGGTCTGCTCGCCCGACTAC
TGGGTGCGTCACGCCCGCGAGGCCGTCCGCTTCCACGACGGGGTGCGCACCCTGGAGGCG
GCAGGCGTCACGACGTTCGTCGAACTCGGCCCGGACGGCGTCCTGACGTCGATGGCCCGG
GACTGTGTCACCTCGACGGACACCGCCTTCGTCCCCGTCCTGCGCGGCTCGCGTCCCGAG
GTCCGCGCGGCCGCCGGAGCACTGGGCCGCCTCCACGCGCACGGGGTCGCGGTCGACTGG
CGGCGCTTCTACGACGGCTGCGGCGCCGTACGCGTCGACCTGCCGACGTACGCCTTCCAG
CGACGCCCGTACTGGATCGACGTGCCCGCGGCACCGGGCGATCCGCGCGAGACCGTACCG
GCACCGCGGGACGAGGCAGCGGGCAGGCCCGAACCCGAAGAGGCGTCGGCCGGCACGGCC
GAAGCCGAGGGTGTGAAGGCCGGTACGGCGGACGACCCGGGGTTGTCGGGACGGGGTGGG
CGGGAGGCCGGGCGGAGCACCTCGGCGCCGAAACCGGCCACGCGCGAGCGGGCCATGGCG
GACGTGGTCCGGGCCCAGGTGGCGACCGTGCTGGAGCACGACGCGCCCGGTGACATCGAC
CTGCGCACCACCTTCAAGGGGCTGGGCTTCGACTCCCTCACCCTGGTCGAACTCCGCGAC
CGGCTGACCCGGGCCACCGGACTCCGCCTCACGCCCTCGGCGCTCTTCGACCACCCCACA
CCGGCCCGGCTCGCCGAGCACCTGCGCACCCTCGTCGAGGGCGACGCGCCGCAGGACACG
CCCGACGCGTCGGCGGCCCCGGCCCCGGACGACGACCCCGTCGCGATCGTGGCGATGGCG
TGCCGCTTCCCCGGGGGCGTGGCCTCCCCCGACGACCTGTGGCGGCTGGTGGCCGAGGGC
GGCGACGCGATCTCCGGGTTCCCCACCGACCGCGGCTGGGACATGGACGCCCTGTACGAC
CCCGACCCCACCCGGACCGGGAAGAACTACGTGCGCGAGGGCGGGTTCCTGGACTCCGCC
GCCGACTTCGACGCCGCGTTCTTCGGCATCTCCCCCCGCGAGGCCCTCGCCATGGACCCG
CAGCAGCGGCTGCTCCTGGAGACGTCGTGGGAAGCGCTGGAGCGGGCCGGCGTGGCCCCT
GGCTCCCTGCGCGGCACCCGCACCGGGGTGTTCGTCGGCACCACCTTCCAGGACTACGGA
CCCCGGCTGCACCAGGGCACCGAGACCACCGAGGGCTACCTCCTGACCGGTGGCACACCG
AGCGTGGCCTCCGGGCGGATCGCCTACACCCTCGGCCTGGAGGGACCCGCGGTGACCGTC
GACACGGCGTGCTCCTCCTCGCTGGTCGCCCTGCACATGGCCTGCCGGGCGCTGCGGGCC
GGGGAGTGCACGATGGCCCTGGCCGGCGGGGTGACCGTGATGGCCACGCCGGGCATGTTC
GTCGAGCTGAGCCGGCAGCGGGCCCTGTCCCCGGACGGCCGCTGCAAGTCCTTCTCGTCA
GCCGCCGACGGCACCGGATGGGCGGAGGGCGCAGGCGTGCTCCTGGTGGAGCGGCTGTCC
GACGCCCGCCGCAACGGGCACCGGGTGCTGGCCGTCGTGCGCGGCTCCGCGATCAACCAG
GACGGCGCCAGCAACGGGCTCACCGCACCCAACGGCCTTTCCCAGCAGCGGGTGATCCGC
CAGGCCCTCGCCGACGCCCGGCTCTCGGGGGCGGACGTCGACGTGGTCGAGGCGCACGGC
ACCGGCACCCGGCTGGGCGACCCGATCGAGGCGGACGCCCTGCTGGCCACCTACGGGCAG
GACCGGCCCGCGGACCGGCCGCTCCGGCTGGGCTCCGTGAAGTCCAACATCGGGCACACC
CAGTGCGCGGCCGGGGTGGCCGGCGTGATCAAGACGGTCATGGCGATGCGGCACGGGCTG
CTGCCGCGCACCCTGCACGTGGACGAACCGTCCCCGCACATCGACTGGACGTCGGGCGCG
GTGTCCCTGCTGACCGAACCGGTGGACTGGCACGTCGGGGACCGTCCCCGACGCGCCGGC
GTGTCCTCCTTCGGCATCAGCGGAACCAACGCCCACGTGATCCTCGAGGACGTGCTCGAC
GACCAGGAGCCGTCGTCCCCCGAGGACGACGCGTCGGCGACCCCCCTGGTCCTCTCCGCG
GACGATCCGCAGGCGCTGCGCGCACAGGCCGCCCGGCTCCACTCCTTCGTCGAACAACGG
CCCGACATCCCTCTGTCCGACGTCCGGTTCACCCTCCTGCACGGGCGGGAGGCCCTGGAC
CAGCGCGCGGCTGTGGTCGGACACGACCGCGCGGACGTGCTCGCCGCACTGGCGGACCTG
GCCGGGGGTGAGGCGGGAGCGGGTGTGCTCACGGGAGGCGTCGGCGGTGTCGGCAAGGTG
GTGTTCGTCTTTCCCGGTCAGGGTTCGCAATGGCCCGGCATGGGACGCGAACTCCTCGAC
ACCTCACCCGTCTTCGCCACCCACATCGCCGAATGCGAAGCCGCCCTCACCCCGTACGTC
GACTGGTCCCTGACCGACGTACTACGCCAGGGCGAACCCCTGGACCGCATCGAAATACTC
CAACCGGTCCTCTTCGCCCTCATGGTCTCCCTCGCCCGCCTCTGGCAACACCACGGCATC
CACCCCGACGCCGTCACCGGCCACTCCCAAGGCGAAATCGCCGCCGCCCACATCGCCGGA
GCCCTCACCCTCGACGACGCCACCCGCATCGTCGTCCTACGCTCCCAGCTCTTCGCCGAC
CACCTCACCGGACACGGCGCCATCGCCTCCCTCACCCTCCCCGCCACCCAAGTAACACAC
CAGCTCGCCCAGTACGACGGACGCCTCACCATCGCCGGCATCAACAGCCCCACCACCTGC
ACCGTCGCCGGACCCCACACCGACCTCACCACCCTCACCCACTGGGCCCGCCAACAAGGC
GCCCGCGCCCGCATCATCGACACCACCGTCGCCTCCCACAGCCCCCACGTCGAACCCCTC
CACGACGACCTGATCCACCTCCTCGCCGACATCAGCCCACAGGCCGGCACCATCCCCATC
TACTCGACCGTCACCACCGAACCCATCGACGGCACCCAGCTCACCGCCGAGTACTGGTAC
GACAACTGCCGCCACCCCGTCCGCTTCCACGACACCCTGCACACCCTCACCACCCACGGC
CACACCCACTACCTAGAAATCAGCCCCCACCCCGTCCTCATCCCCGCCATCACCGAAACC
CACCCCACCGCCACCACCATCCCCACCCTCCACCGCAACCAAGGCACCACCACCGACCTC
CACACCAGCCTCGCCCACGCCTGGACCACCGGACTCCCCACCACCTGGACCAGGCCGCGA
TCCGGGGACACCCACATCCCCGATCTGCCCACCTACGCCTTCCAGCACCAGCGGTACTGG
CTCACCGAGCCCACCACCGTCGACGATCCCAGTGCCTACGGCCTGCACGCCACCCAGCAC
CCCCTCCTGACCGCCGCCCTGCACGACGCCGAGACGGGCCGCGTCACGCTGACGGGGCGC
ATCGCCCCGCGCACGCACGCCTGGCTCGACGACCACGCCGCGCACGGGACCCCGTTGCTG
CCCGGCACCGCCTTCACCGAGCTCGTTCTGCACGCCGGTGCCGAGGTCGGCTGCCCTTAC
GTCGAAGAGCTGACGCTGCACACACCGCTGCCGCTGGCGGCGCCCGTGCAGATCCAGCTC
GTCGTCGACGCGCCCGGCGACGGCGGGGAGCGCACGGTGCGCCTCTACTCCCGACCCGTC
CGGCCCTCCCGGCCAGGAGACGCGGCAGACCCCGACGAACCGTGGACGCACCACGCGACC
GGTGCCGTCTCGGCAGCCCGGGGTGAACAGGCCGCTGAGCTGAGCGAGTGGCCCCCGCGC
GGTGCTCAAGTGCTCCCGGTCGAGCGGTTCTACGACGACGCGGCGCTCACGGGTTACGCG
TACGGGCCGTCCTTCCGGGGGCTGGAGAGGGCGTGGCGGCTCGGCGACGAGGTGTATGCC
GACGTCCGGCTGTCCGAGGAGCAGGTGGAGGAGGCCGGCCGGTACGCGATCCATCCCGCC
TTGTTCGACGCGGCGGTGCACACCGCGCTGGTGGACTCCGTGGGTGAGGGCGCGTCGGTG
CGGCTGCCCTTCGCCTGGTCCGGTGTCGCCCTGCACGCCGTGGGGGCGACGTCCCTGCGG
GTACGGGCCACGCGCACCGGTGCGGACTCGGTTTCGCTGGACCTGGCGGACCCCGCGGGC
CGGCCGGTGGCGACCGTCGGCTCGCTGACGTTGCTGCCGGTGACGTCCGAGCAGGTGCGC
GGTGTGTCCTCGGCGGGGCATGACGACCTGTACCGGATCGAGTGGACGACGCTCACCGCG
TCGACGACCGTCGAGGACCGGCCGGCCTCGGCGTCCTGCGCCGTGATCGGCCGGAACGCC
GGTCCGGAATTCGGGGCGTCCGTCCGCGCCTACGGGAGTGTCGCCGAGCTGGTTTCGGCA
CTCGACGCGGGTGAGCCGGTCCCGGAGCTGGTCCTCCTCCCGGTCACCGCACCCACCGGT
GAGGAGGAGGTCGCCGCCGCGGCTCGTCACACCGCCGAACGGGTGCTCGGCGTCGCCCAG
GAGTGGTTGGCCTCGGAGCACACGGAGTCCTCGCGGCTGGTCGTCGTGACACGGGGCGCC
GTCGCCGTAGGCGGGGAGAGCGGACGGGTCGATCTCGCGCTCGCGCCGGTGTGGGGGCTG
CTGCGGTCGGCCCAGGCCGAGAGCCCGGGTCGGTTCGTCCTCGTCGACGTGGAGGCCGAA
GGCGGGTCGCTGGCAGCCGGCGGGGCGTCCGTAGCGGCCGGCGAGGCGTCGGTGAAGGCC
AATGGGGGGTCACCGGAGGCCGACGGAGGGTCCCAGGAGGAGGGCAGCGGTTCGGTGGTC
GCCGCGGTGGCGGCCGTGCTCGCCACGGACGAGCCCCAGCTCGCCGTGCGCGGGGGCGAG
GTCCGGGTCCCGCGGTTGCGCCGGGCGACGACCGCGGAGGCGGACGCGGAGTCGAAGTCG
GAGGCGAAGTCTGAGGCGGAGGCGGCGACGCCCTGGTCCGCGTCCGGCACGGTGCTCGTC
ACGGGTGGCACCGGCACGCTGGGCGGTCTGGTCGCCCGCCACCTGGTGGCCGAGCACGGC
GTACGTCACCTGCTGCTCACCAGCCGCCGGGGCGCGGACGCCCCTGGTGTCGGCGCACTC
GTCGCGGACCTGAACGCGGCGGGAGCGCAGGTCACCGTGGCGGCCTGTGACGCGGCGGAC
CGGGACGAGCTGGCCCGGGTGCTGGCCGACGTCCCGCACGGGCATCCGCTCGCCGGGGTG
GTGCACGCGGCCGGCGTACTGGACGACGGTGTGATCGGTGCGCTGACCCCGGCCCGTCTG
GAGCGGGTGCTGCGGCCGAAGGTCGACGCGGCCGTGAACCTCCACGAGCTGACGCGGGGA
TCGGACCTTTCCGCGTTCGTGCTCTTCTCGTCCGTCGCGGGTGTCTTCGGCAACCCGGGT
CAGGCCAACTACGCGGCCGCGAACGCGTTCCTCGACGCGCTGGCCGAACGCCGGCGTGCC
GAGGGCCTCCCGGGCGTGTCGCTGGCGTGGGGGCTGTGGGCCGAGAGCAGCGGCATGACG
GGCCACCTCGCCGCCGACGACCTGTCCTGGATGGCGCGTTCGGGCATCCGCTCCCTGCCC
TCCGACACCGGCCTGGCCCTGTTCGACGCGGCGACCGACGGCGCCGGGAGCGGCCTGCTG
GTGCCGGTGGCGCTGGACGGCGCGGCGCTGCGCGAGCGGGCCGCCTCCGGCCTGCTCCCC
CACCTGTTGCAGGGGCTCGTCCGTACCCCGGTGCGCCAAGCCGCGCGGCGCGGGGCGGAA
CCCGACGGCTCCGCACTCGCCACACGGCTGTCCGGGCTCGGCGACGCCGAGCGCGACGAG
CAGTTGCTGACGCTCGTGCGCAGCCATGTCGCCGCCGTCCTCGGGCACCGCTCGCCGCAG
ACCATCGACGCCGAACGGGCGTTCAAGGAACTGGGCTTCGACTCGCTCACCGCGGTCGAG
CTGCGCAACCGGCTCGCCGCCGCCACCGGGGTGCGCCTGCCGGCCACGCTCGTCTTCGAC
CACCCGACGCTCACCTCGGTCGTCGAACGGCTGCGGACCGCCGTCCTGGGAACCACGCCC
ACCGCCGTGAGCCGGCCGCCGGCGGTCACCCGCGCGGCCACCGACACCGAGCCGATCGCG
ATCGTCGGCATGGCCTGCCGCTACCCGGGGGACGTACGGTCGCCGGAGGACCTGTGGCAA
ATGGTGGCCGAGGGCCGGGACGTGATCGCCGGCTTCCCGGCCGACCGCGGCTGGGACCTG
GAGGGCCTCTACGACCCCCAGTCGGCCCGGCCCGGCACCTCGTACGCCCGCGAGGGCGGG
TTCCTCCACGATGCGGGCCACTTCGACCCCGCCTTCTTCGGCATCTCCCCGCGCGAGGCC
CTCGCCATGGACCCGCAGCAGCGGCTGCTGCTGGAGACCTCGTGGGAGGTCTTCGAGCGG
GCGGGACTGGACCCCACCGCCCTCAAGGGCAGCCGGACCGGCGTCTTCGCCGGCCTCATG
CACCACGACTACGCCGGCCCCGGCGACCGGCTCCCCGAGGGCGTCGAGGGCTACGCCCTC
ACCGGAACGCAGGGCAGCGTGGTCTCGGGCCGCATCGCCTACGTCTACGGCCTCGAGGGC
CCGGCGGTCACGGTCGACACCGCCTGCTCCTCCTCGCTCGTCGCCCTGCACCTCGCCTGC
CAGTCCCTGCGCAACGGCGAGTGCGAACTGGCCCTCGCGGGCGGTGTCGCGGTGATGGCG
ACGCCGGGCGTCTTCGTCGAGTTCAGCAGGCAGCGGGGCCTCGCGGCGGACGGCCGCTGC
AAGTCCTTCGCCGCGGCGGCCGACGGCACGGGCTGGTCGGAGGGTGTCGGACTGCTGCTG
GTGGAGCGCCTGTCCGACGCCCGCCGCAACGGCCACCGGGTCCTGGCCGTCGTCCGCGGC
TCCGCCGTCAACCAGGACGGCGCCAGCAACGGCCTCACCGCCCCCAACGGCCCCTCCCAG
CAACGCGTGATCCACCAGGCGCTCGCCAACGCCCGCTTGACCCCAGGTGAGGTGGACGCG
GTCGAGGCGCACGGCACGGGCACCAGGCTCGGTGACCCGATCGAGGCGCAGGCACTCCTC
GCGACCTACGGGCAGGAGCGGGCGGAGGACCGTCCGCTGTGGCTCGGCTCGGTGAAGTCG
AACATGGGGCACGCACAGGCCGCGGCCGGGGTCGCCGGCGTCATCAAGATGGTCATGGCC
ATGCGGCACGGCCTGCTGCCCCGCACCCTGCACGTCGACGAGCCCACCCCGCACGTCGAC
TGGAGCACGGGAGCCGTCTCCCTGCTCACCGAGGACACCACCTGGCCCGAGACGGGCCGC
CCGCGCCGGGCCGCCGTCTCGTCCTTCGGCATCAGCGGCACCAATGCCCACGTGGTCCTC
GAAGCCCCGGCACCGGTCACGGACGAGCCCGGCGACGGACCCACCGGCACCCCGCCGTGG
GTGGTCTCGGGCCGCTCACGCACGGCACTGCGCGCCCAGGCGGCACGGCTGGTGTCGTAC
GTGCAGGAGAGGGAGGACCTGCCCGCCGCCGACGTGGGCACCGCCCTGCTGACGACACGG
GCGGCCCTGGAGCATCGTGCGGTGGTCCTGGGCCCGGACCGCGACCAGCTCCTGGAGGGC
CTGCACGCACTGGCCGACGAACAGGACAGCCCCCGGGTCGTGACGGGGAGCGTGCGGCCG
GGGCGGCTGGCGTTCATGTTCACCGGCCAGGGCTCCCAACGCCTCGGCATGGGCCACGAG
CTCTACGACACCGAACCCGCCTTCGCCGCAGCACTGGAAGAAGCCTTCGCGGCACTGGAC
CCACACCTGCCACGGCCCTTGCGCGAGATCGTCTTCGGCGACGACCCGGAGCTGTTGCAG
CAGACCCAGTACGCACAACCCGCACTCTTCGCCGTCGAGACCGCCCTCTACCGGCTCCTC
ACCGACACCTACGGCCTGCGCCCCGACTACCTCCTCGGCCACTCCATCGGAGAACTCACC
GCCGCCCACGCCGCCGGCGTCCTCACCCTGCCCGACGCCGCACGCCTGGTCACCGCCCGC
GGACGCCTCATGCAAACCGCACCCACCGGCGGAACCATGATCGCCATCCAGGCCGACGAA
AACGAGATCACCCAGCAGCTCACCCCGGGGGTCGACATCGCCGCCCTCAACTCCCCCAGC
AGCACAGTCATATCGGGTGACACCGCCGAGGCAGAAGCCATCGCGGACCGCTGCCGCGCC
CTCGGCCGCAAGACCAGCCGGTTGAAGGTCTCCCACGCCTTCCACTCCCCCCACATGGAC
CCCGTCCTCGACGACTTCCGGCAGATCGCCGCCACCCTCGACTACCACCCCGCCCGCATC
CCCGTCATCTCCAACACCACCGGACAGCCCGCCGAAAACCTCACATCCCCCGACTACTGG
ACCCAGCACATCCGCCGCCCCGTCCGCTTCACCGACAGCCTCCACCACCTCACCCAGCAG
GGTGTGACGACCTTCCTCGAACTCGGACCCGACGCCACCCTCACCGCCCTCACCCGCACC
ACCCTCGACGACACCCACGCCACCGCCGTCCTGCGCAAGGACCGCACCGACACGGACGCC
CTGCGCACAGCCCTCGCCGAGCTCTGGGTGCACGGCACCCCCGTCACCTGGCCGCACCCC
GCCGACCGGCACATCGACCTGCCCACCTACCCCTTCGACCACCAGCACTACTGGCTGCCG
TCCGGGTCAGGTGCCGTGGTCGACGCGGCCGGGCTGGGGCTCGGGGCGACCCACCACCCG
GTGCTCGGCGCGGCGGCCGTGCTGGCGGACTCGGAGCAGCACCTGTTCACCGGCCGAGTG
TCCCTGCGCACGCATCCATGGCTCGCGCACCACACGGTCGGCGGAGCCGTGCTGCTTCCG
GGCACGGTCCTCGTGGAGGCCGTGCTGCGGGCCGGTGACGAAGTCGGCTGCTCGCGGGTC
GAGGAGCTGACGCTGGAGGCGCCGCTGGTCCTGCCCCGTCACGGCGCGGTCCAGCTGCAA
CTGCTCGTCGGACCGCCGGACGCCGACGGCAGCCGGTCGGTCCAGGTGTACGCACGGCCC
GAGGACGACGGTCGAAGCACCGCGTCGTGGGTCCGCCATGCGAGCGGCTCGCTCGGTACG
GGTGACGGCGCCGAGCCCGCCGGCCACACCGTCTGGCCTCCCACGGGCGCCGTGCCCCTG
CCGGTCGAGGACTTCTACGACGGTCACGGCAAGGGGTACGGCCCGGGATTCCGCGGTCTG
CGCAGCGCCTGGCGGCACGGTGAGGACCTGTACGCCGAGGTGGTCATGCCCGAGGAGCTC
AGCCAGGCCGCCCTCTCGCCGGGCGAGTTCGGCATCCACCCGGCCCTGCTGGACATCGCC
CTGCACACCGTGTTGCTCGACGACTCCGGCGTCCGGCCGTCCGCACGGCTCCCCTTCGCC
TGGAGCGACGTGACCCTGCACGCCACCGGAGCGACGGAGCTGCGGGTCCGCGTATCCGGC
TCGGCGGACGACACGTTCAGCGTGGAAGCGTCGGACCCGACCGGGCGGCCGGTGGTGTCG
ATCGGCTCGCTCGTCCTGCGGCCGGTCTCCGACGAACAGCTGCGCACAGCCGACGGTGGC
GGAGCCGACTCCGACGCTCTGTTCCGGGTCGACTGGTCTCCATTCGCCGTCGACGGCCCC
GGGTCGCAGGGTGCCGACGGCGACTGGGCCGTGATCACTGCCGCGGCGAGTGAACTGGCC
GTCGTCCTCGGTGAGGCGCGCGATTCCCTACGCACCTGCTCCGACCTGTCGGCGCTCCGT
GCCGCAGTCGGGGGCGGTGAGCCGGTACCGGAGGCGGTGGTCCTGCCGTACGTCACCCCG
CATCCTGCCGACGGTGACGGTCTCCCGGCCGAGGTCCACCGTGCCACCAGGCAGGCACTC
GCCGATGTCCAGACGTGGCTGGCGGACGAGGCGCTGGATGACTCACGCCTGGTCGTGGTG
ACGCGGCGCGCCGTGGCGACCCACGCGGGAGAGGACGTCGGCGACCTGGTGCACGCCGGT
GTCTGGGGCCTTCTGAGGTCGGCGCAGTCGGAGCATCCGGGCCGGCTCTTCCTGCTGGAT
CTCGACGACGACCCGGCCTCGTACGCCGCGCTGCCGGAGGCCGTCGCGTCCGCCGAGCCG
CAACTCGCCGTGCGCCAAGGCGCCATGCTCGTGCCTCGGCTGTTCCGATCGGTCACGGAC
GGCGAGTTGAGTCCGCCGTCCGACGCCGACGCCTGGCGGCTCGACACCGTGCGCCCGGGG
ACACCCGACGATCTCGAGCTGCTTGCGTGCCCGGACGTCCTCGCTCCCCTCGGTCCCGGA
CAGGTGCGGGTGTCCGTGCACGCGGCCGGGCTGAACTTCCGCGACGTCCTGATGGCACTC
GGCATGTACCCGGGTGAGCTGTCCCTGGGGAGCGAGGGAGCAGGGATCGTCACCGCAGTC
GGTCCGGGCGTCTCGCGCTTCGAGGTCGGGGACCGGGTCATGGGCATGCTCCCGCGGTGC
TTCGGCCCGTTCGCGGTGGCCGACCAGCGTACGGTCGTGCGGATGCCGGAGGGCTGGTCG
TTCGAGCAGGCCGCCGCCGTGCCGGCCGTCTTCCTGACCGCCTACTACGGTCTCCGCGAC
CTCGCCGATCTACGGGCCGGGGAGTCGGTCCTCATCCACGCCGCGGCGGGCGGCGTCGGC
ATGGCCGCCGTCCAACTCGCCCGCCACTGGGGCGCCACCGTCCACGCCACCGCCAGCCCC
CACAAGTGGGACACCCTGCACGCCCTGGGCCTGGACGACGACCACATCGCCTCCTCCCGC
ACCCTCGACTTCCGCGACCAGTTCACCGAAGTCGACGTCGTCCTCAACTCCCTCACCGGC
GCATACATCGACGCCTCCCTGCACCTCCTGCGCAACGGCGGCCGCTTCATCGAAATGGGC
AAGACAGACATCCGCCCCACCCCACCCCACGTGTCCTACCACGCCTTCGACCTCATGGAA
GCCGGACCCCAACGCCTCGGCGACATGCTCACCGACATCGTCCAGCTCCTCCAGACCGGC
ACACTCACCCACCTCCCCCTCGACACACGCGACATCCGCCAAGCCCCCCAGACCTTCCGG
CACATGAGCCAGGCCCGCCACACCGGAAAAATCGTCCTGCGCATACCCCAGCCCCTCGAC
CCACACGGCACCGTCCTGATCACCGGCGGCACCGGCACCCTCGGCGCCCTCACCGCCCGC
CACCTCGCCACCACCCACAACACCCGCCACCTCCTCCTCACCAGCCGCCAAGGCACCGCA
GCACCCGGCGCCACCCAACTCGCAGACGAGCTGCGGGACCTGGGCGCGCACGTCACCATC
GCCGCCTGCGACACCGCCGACCGCACCGCACTGACCCACCTGCTGGACTCGATTCCGGCC
GAGCACCCCCTCACCGCCGTCATCCACTGCGCCGGCACCCTCGACGACAGCACCGTCCCG
GCGCTCACCCCCGACCAGCTCGACGCCGTCCTGCGCCCGAAGGTCGACGCGGCCTGGCAC
CTGCACCACCTCACCCGGCATCTGGACCTGTCGGCCTTCGTCCTCTTCTCCTCCGTCGCC
GGTGTCATCGGCAATCCGGGCCAGGGCAACTACGCCGCCGCCAACACCTTCCTCGACGCC
CTCGCCCACCACCGCCACGCCCACGGCCTCCCCGCCACCAGCCTCGCCTGGGGCCAGTGG
CAGCAGGCCAGCGGCATGACCGGGGAGCTGTCGGAGGCCGACCTCGCGCGGTTGTCCCGT
GCCGGCATCCGTCCCATGCCGACCGACGAGGCTCTGGCGCTCCTCGACGCCGCTACGGGC
ACCTTCACGGAAGCCTTGCTCGTACCGGCGCGGCTGGACCTCAAGGCGCTGCGCGCGCGC
GAGGTCGAGGGGGCTCTGCCGCCGCTTCTCCGGGACCTGGTGCGGGCGACGGGGCCCGTA
CGGCGTACCGCGGCGACAGCGCGGGACGCGGCCGAGGGACCGTCGTTCGCTCAGCGGCTG
GCGTCGCAGAGTCCGGCCGAACGGCGCTCCAGCGTGCTGGAGTTGGTGCGCACGCACGTG
GCAGCGGTCCTCGGGCACGCCTCGCCTGGCGCGGTGGGGGCGACGAGCTCGTTCAAGGAG
ATCGGCTTCGACTCCCTCTCCGCTGTCGAACTGCGCAACCGACTGGGTGCGGCGACCGGA
CAGCGGCTGCCCTCGACGCTCGTCTTCGACTATCCGACCTCGGAAGCTCTCGCCGGGCAC
CTGCTGGAGCAACTCGCCCCGCAAGGGCCGCAGGACTCCGTCTCCGTGCTGGGCGAGATC
GACCGCCTGGAGTCGGCGCTCGCCTCGGTCGGGACCGACGGTCAGGACGACGGCACGATC
ACGACCCGCCTCGAACTGCTCCTGGCGAAATGGAAGGAAGCGCAGAACTCTGCCGCGCGC
GCCAGTGTCGCGGACCGGCTCCAGGCTGCGACGCCTGACGAGGTCCTCGATTTCATCGAC
AACGAACTCGGGGTCTCGTGA
[0] KSQ17..381
[0] AT536..858
[0] malonyl-CoA731..735
[0] ACP959..1029
[1] KS1052..1428
[1] AT1581..1892
[1] ethylmalonyl-CoA1770..1774
[1] DH1940..2108
[1] KR2476..2656
[1] ACP2762..2832
[2] KS2857..3233
[2] AT3385..3693
[2] malonyl-CoA3572..3576
[2] DH3739..3900
[2] ER4240..4533
[2] KR4543..4723
[2] ACP4832..4902
[0] KSQ49..1143
[0] AT1606..2574
[0] malonyl-CoA2191..2205
[0] ACP2875..3087
[1] KS3154..4284
[1] AT4741..5676
[1] ethylmalonyl-CoA5308..5322
[1] DH5818..6324
[1] KR7426..7968
[1] ACP8284..8496
[2] KS8569..9699
[2] AT10153..11079
[2] malonyl-CoA10714..10728
[2] DH11215..11700
[2] ER12718..13599
[2] KR13627..14169
[2] ACP14494..14706

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [534-660]  G3DSA:3.40.366.10 [730-837]  G3DSA:3.40.366.10 [1578-1701]  G3DSA:3.40.366.10 [1770-1882]  G3DSA:3.40.366.10 [3375-3507]  G3DSA:3.40.366.10 [3572-3683]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [4367-4388]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [987-1002]  PS00012 [2790-2805]  PS00012 [4860-4875]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [952-1068]  7.00000734129907e-28 SSF47336 [2755-2873]  2.30000440726534e-28 SSF47336 [4824-4919]  6.59999852526376e-23 SSF47336
SSF47336   ACP_like
 [958-1032]  6.29999999999997e-67 G3DSA:1.10.1200.10 [2760-2834]  6.29999999999997e-67 G3DSA:1.10.1200.10 [4830-4906]  6.29999999999997e-67 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [959-1029]  PS50075 [2762-2832]  PS50075 [4832-4902]  PS50075
PS50075   ACP_DOMAIN
 [962-1028]  4.6e-14 PF00550 [2766-2831]  3.1e-13 PF00550 [4835-4901]  2.8e-10 PF00550
PF00550   PP-binding
IPR011032 GroES-like (Domain)
 [4226-4374]  1.40000506907309e-35 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [4378-4471]  1.3e-12 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [4259-4315]  1.1e-08 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [2476-2655]  4.30000000000003e-65 PF08659 [4543-4722]  1.99999999999999e-65 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [17-259]  2.99999999999998e-81 PF00109 [1052-1302]  3.39999999999996e-100 PF00109 [2857-3107]  2.70000000000002e-98 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [267-381]  2.29999999999998e-38 PF02801 [1310-1428]  9.9e-48 PF02801 [3115-3233]  3.40000000000004e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [536-858]  2.29999999999998e-60 PF00698 [1581-1892]  8.60000000000004e-91 PF00698 [3385-3693]  6.20000000000009e-68 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [533-841]  2.7000136937899e-70 SSF52151 [1579-1868]  1.69998802370953e-71 SSF52151 [3382-3670]  4.69998262513189e-75 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [665-730]  4.60000044330862e-18 SSF55048 [1704-1769]  8.60000664726925e-12 SSF55048 [3509-3571]  6.49999377884395e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [17-270]  G3DSA:3.40.47.10 [271-433]  G3DSA:3.40.47.10 [1054-1314]  G3DSA:3.40.47.10 [1315-1478]  G3DSA:3.40.47.10 [2859-3119]  G3DSA:3.40.47.10 [3120-3283]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [9-378]  2.80000504261099e-86 SSF53901 [1044-1426]  2.80000504261099e-107 SSF53901 [2849-3231]  1.90000694315261e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2476-2663]  1.69999999999998e-74 G3DSA:3.40.50.720 [4375-4468]  2.3e-17 G3DSA:3.40.50.720 [4543-4726]  1.10000000000001e-71 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1215-1231]  PS00606 [3020-3036]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [537-838]  1.19999063421924e-123 SM00827 [1583-1874]  5.29997329885557e-118 SM00827 [3386-3675]  1.09999184471405e-121 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [960-1032]  5.10001002358244e-29 SM00823 [2763-2835]  3.10001307370206e-33 SM00823 [4833-4905]  4.69998262513195e-35 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [1940-2108]  5.20000089003336e-64 SM00826 [3739-3900]  4.80002938964646e-72 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [19-434]  SM00825 [1054-1480]  SM00825 [2859-3285]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2476-2656]  5.60004908290974e-67 SM00822 [4543-4723]  1.49999648196323e-61 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [4240-4533]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit