close all open/close all

CDS information : Lasal2_00170


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction34,479 / 50,888 / + [in whole cluster]
34,479 / 50,888 / + [in contig]
Location34479..50888 [in whole cluster]
34479..50888 [in contig]
TypeCDS
Length16,410 bp (5,469 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)lasalocid modular polyketide synthase
Gene
Gene (GenBank)lasAII
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase modules and related proteins
Reference
ACC
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)
Related Reference
ACC
B6ZK65
NITE
Lasal_00140
PmId
[19129623] Identification of a gene cluster of polyether antibiotic lasalocid from Streptomyces lasaliensis. (Biosci Biotechnol Biochem. , 2009)

close this sectionPKS/NRPS Module

3 ethylmalonyl-CoA
4 methylmalonyl-CoA
5 ethylmalonyl-CoA
KS34..410
AT565..876
DH920..1085
KR1414..1592
ACP1693..1767
KS1789..2164
AT2322..2640
DH2689..2863
ER3179..3471
KR3481..3661
ACP3766..3836
KS3860..4236
AT4388..4699
KR5020..5199
ACP5304..5374

close this sectionSequence

selected fasta
>polyketide synthase [lasalocid modular polyketide synthase]
MANQDKLVDYLKRVATDLHETRQRLRAVEEKDQEPIAIVGMACRFPGGADTPERLWELVA
EGRDAITGFPTDRGWDLDALFDPDPDRSGTSYTRSGGFLLDAAEFDPAPFGISPREALAM
DPQQRLMLEVSWEVLERAGIAPDSLKGSATGVYVGAGNLGYLVGMQQARPGVEGHSLTGN
IGSIISGRISYTFGLEGPAVTVDTACSSSVVALHSAVQALRNGECSLALAGGVTIMPNPV
EFVEFSRQRVLSPDGRCKAFGATADGTGFSEGVGVLLVERLSDARRNGHRVLAVVRGSAV
NQDGASNGLTAPNGPSQQRVIRQALANARLAPADVDAVEAHGTGTALGDPIEAQALLATY
GQDRPTEQPLWLGSIKSNIGHTQAAAGMAGIIKMVMAMRHGILPRTLHVDEPSPHIDWTA
GAVSLLTEPVDWQAGDRPRRAGVSSFGISGTNAHVILEQAPVDDASSSEPVERDSGPVSW
VLSGKTAQALRAQASQLHSLAESEPALDAHAVEAALATTRAALEHRAVVLSEDREGLVEG
LHALAQGRPSPQVVTATTENRGKTVFVFPGQGSQWPGMGRELLDTSPVFATHITECEAAL
TPYVDWSLTDVLRHGEPLDRIEILQPVLFALMVSLARLWQHHGIHPDAVTGHSQGEIAAA
HIAGALTLDDATRIVVLRSQLFADHLTGHGAIASLTLPATQVTHQLPQYDGRLTIAGINS
PTTCTVAGPHTDLTTLTHWARQQGARARIIDTTVASHSPHVEPLHDQLLHLLADISPQAA
SVPIYSTVTTEPIDGTQLTAEYWYDNCRHPVRFHDTLHTLTTHGHTHYLEISPHPVLIPA
ITETHPTATTIPTLHRNQGTTTDLHTSLAHAWTTGLPTTWHTPHHHLDLPTYPFQRQRYW
LTETTTADDPSAYGLHATQHPLLTAAIHHAETGRLMLTGRLTAHAHPWLSDHSAHGTTLL
PGTAFTELVLHAAQYTATPHIHELTLENPLVLDAQSATQLQITVAPEGAAGRMTARIHSR
PENPHDPTTPWRHHATATLTAEAADVAVPPPADWPPADARLLDTEGLYTEAEQSGYGYGP
AFQGLRRAWRGASDLYAEVALPHERHEEAAGYGLHPALFDAALHALLLDRSGGDTTVRLP
FVWSGVSLHAASATALRVRISPVGENEFTLVATDGAGGAVVTVERLTVLPVSAEQVRESA
RSADEEALYRVDWVPVPVSAPDRHPNTVGGAPSWVAIGADAPATRAVAASYPDVDALVAA
LDSGAGVPEVALLFCGPGRGGAVTDEVRQGTSALLDAVRTWLADDRFDASRLVVVTRGAV
AVLPGEGVDDLAQAALWGLVRSAQSENPGRFLLLDSDTDVPEEAVRRLAASGDEQAALRE
GALLTPRLARASVPSGTEAESSAAGAPFSSEGTVLVTGGTGTLGGLVARHLVAEHGVRHL
LLLSRQGADAPGAGGLADELAASGARVTFAACDASDREALAGVLASVPADRPLTGVVHAA
GALSDATVAALTPEHLERVLRPKADAAAHLDELTRDLDLSAFVLFSSAAGVLGNPGQANY
AAANTFLDALAERRRAQGLPAVSVAWGLWAPSSAMRAHLGERDEARIVGSGVLPMPAEQG
LALLDAALRADRPLVVAARLDPSALRRRAQDGTLPGVLRGIVRVPVRRATADGTDDGGSA
LLRRLAGLQEADQERELAALVRGEAAAVLGHADPSSLDLAQPFRTLGFDSLTAVQLRNRL
AAVTGLRLPAGLVFDHPSPAAVARHLRTELTGAAESTVAPVPVAAAGTDEPVAIVGMACR
FPGGVRSPEDLWRLVVDGGDAVSDFPADRGWDLDALFDPDPDHPGTSYARQGGFLLDAAD
FDAGFFGISPREALSMDPQQRLLLETSWEVFERAGIDPATLKGSRTGVFAGAMYQEYAAN
VAPETVEGHFLSGTSSSVVSGRVSYTFGLEGPAVTIDTACSSSLVALHLAAQALRNGECE
LALAGGVAVMTTPVLFTEFSRQRGLAPDSRCKPFAAAADGTAWSEGVGVLLVERLSDALR
NGHRVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALANARLTPADVDAVEAHGTGTT
LGDPIEADALLATYGQDRPEDRPLWLGSVKSNIGHTQAAAGMAGIIKTVMAMRHGLLPRT
LHLDEPTPHVDWTSGRVALLTEPVAWPVSDRPRRAGVSSFGASGTNAHVILEQALHTTAA
NQDTPSDAGSGALPWLVSGRTAEALREQAARLRSFVQSDEAVELEPSAVAGALAAERATF
GHRAVVLGSDRPDFTDALTALAEGTPHPGVVQATALEVTRTVFVFPGQGSQWTGMGRELL
DSSPEFAAYIAECETALNDFVDWSLTDVLRGTEGAPGYDRVDVVQPALFAVMVSLARLWQ
HHGIHPDAVIGHSQGEIAAAHIAGALTLNDAARIVALRSQALLPLAGLGGMTSLALPHHQ
AHELIQPWGQDLSIASVNGPHSTVVSGTTHALDELHTTCNTQGVRARRIPVDYASHSAQV
ESIRDTVLQAATGINPQPTAVPLYSTVTGQPINGTQLDADYWYTNLRHTVRFEETVRALL
GDDHNAFIEATAHPVLTMAVEETVGAVEREAVVVGTLRRDEGGIDRFRTSLAMAWVRGVG
VDWVGMLGGRGARPVDLPTYAFQRERYWLEPATRTSGDASSLGLEGAGHPLLGAALRLAG
EDGVLLTGRLSREALPWLADHAVAGTVLLPGAAFVELALRAGDEAGCDLVEELTLEAPLL
LPERGGVRLQLVLGVPDAQGRRELGVYARPDGDGDGDGDYGGEAPWTRHARAVLAVAGDA
DRADVALPGAVWPPSGAEALPVADFYADAADAGYGYGPAFQGLRAAWRLGEEMFAEVALP
EQVREEASAYGIHPALLDAALHPALLDQVGGDAQVRLPFVWSGVMLDAVGAGVLRVRISP
SRADSPSGADGLAVSLTDPEGHPVATVGALVSRPLSADQVRQTSGKALESLYRVAWVGLP
ALAANSTTPVPLDEVSDDSAEVPETVLLSCADATADAADAASGIADVVDGVRRAAHELLH
RVQAWLSDARFASSRLVVLTRGAVAASPEDRTTDLVTAPLWGLIRSAQAENPGRFVLLDT
DGTEASAAVLAGAAASDESQLALRDGAVLVPRLVRGAVSGALALPADGSDWRVDSRSPGT
LEGLSVLPGTAAAQPLEPGRIRVAVRAAGLNFRDVLIALGMYPGEATMGSEGAGVVVEVA
PDVTEFAVGDRIVGLIPESFGPFAVVDHRTVVRMPEGWSFEQAAAVPIVFLTAYYGLRDL
ADLRAGESVLIHAAAGGVGMAAVQLARHWGATVHATASPHKWDTLRALGLDDDHIASSRT
LDFSDQFDEVDVVLNSLTGEYIDASLHLLRDGGRFIEMGRTDVRDVSGVFYRAFVLAEAG
PERIGEMLGEVVRLLETGALTHLPLDVRDVRQAPETFRHMSQARHIGKIVLRIPQSPDAR
GTVLITGGTGTLGALTARHLVTTHGTRRLLLTSRQGMAAPGAAPLADELRDLGAHVTIAA
CDTADRTALTHLLDSIPAEHPLTAVIHCAGALDDGTVPTLTPERFEAVLRPKVDAAWNLH
DLTRHLDLSAFVLFSSAAGVLGGAGQANYATANTFLDALAHHRHAHGLPATSLTWGHWEQ
ASGMTGHLDRTDLARIGRTGLLPMSPAYGLALFDAALRESDAVLVPVRLDTGALREQHAG
GALPPVFRELVRGPARRTAATGGAADQSALARTLAGRSTTEQKAILLDLVRTHIATVLGH
TTPDTINPDQPFKDLGFDSLTSVELRNRLTTATGLKLPATLTFDHPTPHALTHHLHQQTT
GTTHPTPINTPPTTAPAPDEPLAIVSMACRFPGGIESPDDLWQYVVQGRDAVSDFPVDRG
WDLERLYDPDPERSGTSYTRSGSFLYDAADFDAQLFGISPREALAMDPQQRLLLETSWEV
LERAGINPRSLRGSQTGVFVGAVNTGYGTGLPHTPEDIEGYLGTGTSSSVASGRVAYTFG
LEGPAVTVDTACSSSLVALHLAAQALRNGECTMALASGVAVMATPLEFVEFSRQRVLSAD
GRCKAFAAAADGTGFSEGVGVLLVERLSDARRNGHQVLAVVRGSAVNQDGASNGLTAPNG
PSQQRVIRQALANARLTPADVDAVEAHGTGTALGDPIEAQALLATYGQDRPTEQPLWLGS
IKSNIGHTQAAAGMAGIIKMVMAMRHGILPRTLHVDEPSPHIDWTAGAVSLLTEPVDWQA
GDRPRRAGVSSFGISGTNAHVILEHVAEVPELSPVDEDSTMPLVLSGHTPEALRTQADRL
HAHLTGRPELPVAQVAASLVATRAALDHRGAVLAEDREGFLEGLHALAQGRPSPQVVTAT
TENRGKTVFVFPGQGSQWPGMGRELLDTSPVFATHITECEAALTPYVDWSLTDVLRQGEP
LDRIEILQPVLFALMVSLARLWQHHGIHPDAVTGHSQGEIAAAHIAGALTLDDATRIVVL
RSQLFADHLTGHGAIASLTLPATQVTHQLTQYDGRLTIAGINSPTTCTVAGPHTDLTTLT
HWARQQGARARIIDTTVASHSPHVEPLHDDLIHLLADITPQPGTTPIYSTVTTEPIDGTQ
LTAEYWYDNCRHPVRFHDTLHTLTTHGHTHYLEISPHPVLIPAITETHPTATTIPTLHRN
QGTTTDLHTSLAHAWTTGLPTTWHTPHHHLDLPTYPFQRQRYWLESAPLSASQGPAGPAD
DTDARFWEAVEREDLEALSSTLSLDGNGEALSWSAVLPSLSSWRRQQREQATLDSWRYRI
SWKRITVPNLPTLTGTWLLVTGPERSGEAWSAVVARAMASRGAQVSTLSVDAAGLDRETL
RERIREHLADSEQPVGVLSLLACGAGTAESGRPGVPSALATTVALVQALGDAGVDAPLWC
VTSGAVSVSATEYALPEQAAVAGLGRVVALEQPQRWGGTIDLPGQLGDVDDQVAVRLVGV
LAEHGDEDQLAVRASGVFGRRLVRAPLGAAAPVRSWKPRGTVLVTGGTGGVGGRVARWLA
TSGAEHLLLVSRSGPEAPGAAELEADLAASGARVSVVACDVADRDAVERLLSSVPDAHPL
TAVVHAAGVPQQSAVEELTPAEVEEILSAKVLGARHLDELLADAPLDAFVLFSSNAGVWG
SGGHSAYAAANAYLDALAERRRAHGRTATSVAWGAWAAGGMMAAEGAAAYMGRRGVLDME
PERAVAALVAAVEHDETFVAVAHMDWERFVLGFTSLRPSPLLDDIPEARRALAELAEETE
SGSDASTLARELADMSPDDRRAALLDLVQSNAAAVLGHTGGAAVDAHRAFKELGFDSLTA
VQLRNRLNAATGLRVPATLVFDHPTPAAVAAYVEAQLLPDVSGARLPVLEEIDRLDASLS
DGPADADLLHAVQDRLQEMLWKLADRSAASGGTASPSGDPDERGATDGDFASATADDMFD
LIDRDLGLS
selected fasta
>polyketide synthase [lasalocid modular polyketide synthase]
ATGGCTAACCAGGACAAGCTGGTCGACTACCTGAAGCGCGTCGCCACCGACCTCCACGAG
ACGCGGCAGCGGTTGCGCGCGGTCGAGGAGAAGGACCAGGAGCCGATCGCCATCGTCGGC
ATGGCCTGCCGGTTCCCCGGCGGCGCCGACACCCCGGAACGCCTGTGGGAGCTGGTCGCG
GAGGGCCGTGACGCGATCACCGGCTTCCCGACGGACCGCGGCTGGGACCTGGACGCCCTC
TTCGACCCGGACCCGGACCGCTCCGGTACCTCGTACACCCGATCCGGCGGGTTCCTCCTC
GATGCGGCGGAGTTCGATCCCGCGCCCTTCGGCATCTCGCCGCGCGAGGCCCTCGCCATG
GACCCGCAGCAGCGCCTGATGCTGGAGGTGTCCTGGGAGGTCCTGGAACGCGCGGGGATC
GCCCCGGACTCCCTCAAGGGGAGTGCCACGGGCGTGTACGTCGGTGCCGGGAATCTCGGC
TACCTCGTCGGCATGCAGCAGGCCCGGCCGGGAGTGGAGGGGCATTCGCTGACCGGCAAC
ATCGGCAGCATCATCTCCGGGCGCATCTCCTACACCTTCGGTCTCGAAGGGCCGGCGGTC
ACGGTCGACACCGCCTGCTCCTCGTCGGTCGTGGCCCTGCACTCCGCCGTTCAGGCGCTG
CGCAACGGCGAGTGCTCGCTGGCGCTGGCGGGCGGCGTCACGATCATGCCCAACCCGGTG
GAGTTCGTGGAGTTCAGCAGGCAGCGGGTGCTGTCACCCGACGGGCGCTGCAAGGCGTTC
GGCGCGACCGCCGACGGGACGGGCTTCTCCGAGGGCGTGGGCGTGCTGCTGGTGGAGCGC
CTGTCCGACGCTCGCCGCAACGGCCACCGGGTGCTGGCCGTGGTCCGTGGCTCGGCTGTG
AACCAGGACGGCGCCAGCAACGGCCTGACCGCACCCAACGGCCCTTCGCAGCAGCGGGTG
ATCCGCCAGGCCCTCGCCAACGCCCGCCTCGCCCCCGCCGATGTCGACGCCGTCGAGGCG
CACGGCACCGGAACCGCGCTGGGCGACCCGATCGAAGCCCAAGCCCTGCTCGCCACCTAC
GGTCAGGACCGGCCCACGGAGCAGCCGTTGTGGCTGGGCTCGATCAAGTCCAACATCGGC
CACACCCAGGCCGCCGCCGGCATGGCCGGCATCATCAAGATGGTCATGGCCATGCGCCAC
GGCATCCTCCCCCGCACCCTCCACGTCGACGAGCCGTCCCCGCACATCGACTGGACCGCC
GGCGCCGTCTCACTGCTCACCGAACCGGTGGACTGGCAGGCCGGTGACCGCCCCCGACGC
GCCGGCGTCTCCTCCTTCGGCATCAGCGGAACCAACGCCCACGTCATCCTCGAACAGGCC
CCCGTCGACGACGCCTCGTCCAGCGAGCCCGTGGAGCGGGACAGCGGACCCGTCTCCTGG
GTCCTCTCGGGGAAGACGGCTCAGGCTCTGCGTGCCCAGGCCTCGCAGCTCCACTCCCTT
GCCGAGTCCGAGCCCGCGCTCGACGCCCACGCGGTCGAAGCCGCTCTCGCGACCACACGC
GCGGCCCTGGAGCACCGGGCCGTCGTTCTGTCCGAGGACCGGGAAGGGCTCGTGGAGGGG
TTGCACGCCCTCGCGCAGGGCCGGCCCTCGCCGCAAGTCGTCACCGCGACCACCGAGAAC
CGCGGCAAAACCGTCTTCGTCTTCCCCGGACAGGGTTCGCAATGGCCCGGCATGGGACGC
GAACTCCTCGACACCTCACCCGTCTTCGCCACCCACATCACCGAATGCGAAGCCGCCCTC
ACCCCCTACGTCGACTGGTCCCTCACCGACGTACTACGCCACGGCGAACCCCTGGACCGC
ATCGAAATACTCCAACCGGTCCTCTTCGCCCTCATGGTCTCCCTCGCCCGCCTCTGGCAA
CACCACGGCATCCACCCCGACGCCGTCACCGGCCACTCCCAAGGCGAAATCGCCGCCGCC
CACATCGCCGGAGCCCTCACCCTCGACGACGCCACCCGCATCGTCGTCCTACGCTCCCAA
CTCTTCGCCGACCACCTCACCGGACACGGCGCCATCGCCTCCCTCACCCTCCCCGCCACC
CAAGTAACACACCAGCTCCCCCAGTACGACGGACGCCTCACCATCGCCGGCATCAACAGC
CCCACCACCTGCACCGTCGCCGGACCCCACACCGACCTCACCACCCTCACCCACTGGGCC
CGCCAACAAGGCGCCCGCGCCCGCATCATCGACACCACCGTCGCCTCCCACAGCCCCCAC
GTCGAACCCCTCCACGACCAACTCCTCCACCTCCTCGCCGACATCAGCCCACAGGCCGCC
AGCGTCCCCATCTACTCCACCGTCACCACCGAACCCATCGACGGCACCCAGCTCACCGCC
GAGTACTGGTACGACAACTGCCGCCACCCCGTCCGCTTCCACGACACCCTGCACACCCTC
ACCACCCACGGCCACACCCACTACCTCGAAATCAGCCCCCACCCCGTCCTCATCCCCGCC
ATCACCGAAACCCACCCCACCGCCACCACCATCCCCACCCTCCACCGCAACCAAGGCACC
ACCACCGACCTCCACACCAGCCTCGCCCACGCCTGGACCACCGGACTCCCCACCACCTGG
CACACCCCCCACCACCACCTCGACCTCCCCACCTACCCCTTCCAACGCCAGCGCTACTGG
CTCACCGAGACCACCACGGCCGACGACCCCAGTGCCTACGGCCTGCACGCCACGCAGCAC
CCCCTCCTGACCGCCGCGATCCATCACGCGGAGACCGGTCGGCTGATGCTGACCGGGCGT
CTGACGGCGCACGCCCACCCGTGGCTGTCGGACCACTCCGCGCACGGGACGACGCTGCTG
CCCGGCACCGCCTTCACCGAGCTCGTGCTCCACGCGGCGCAGTACACGGCGACCCCGCAC
ATCCACGAACTGACGCTCGAGAACCCCCTGGTGCTCGACGCGCAGAGTGCGACGCAGCTC
CAGATCACGGTCGCCCCGGAAGGTGCGGCCGGGCGGATGACCGCGCGGATCCACTCAAGG
CCGGAGAACCCGCACGACCCGACCACGCCCTGGCGGCACCACGCGACGGCCACGCTCACG
GCGGAGGCCGCCGACGTCGCCGTACCGCCGCCGGCCGACTGGCCGCCCGCCGACGCACGA
CTGCTGGACACCGAGGGGCTCTACACGGAGGCCGAGCAGTCCGGGTACGGGTACGGTCCG
GCGTTCCAGGGACTGCGGAGGGCGTGGCGCGGCGCCTCGGACCTGTACGCCGAGGTCGCA
CTGCCCCACGAACGGCACGAGGAGGCAGCGGGGTACGGTCTCCACCCCGCCCTGTTCGAC
GCGGCACTGCACGCTCTGCTGCTCGACCGGTCGGGGGGCGACACGACGGTCCGACTGCCG
TTCGTCTGGTCGGGTGTCTCCCTCCACGCCGCCTCGGCGACAGCGCTTCGGGTGCGGATC
TCGCCCGTGGGCGAGAACGAGTTCACCCTCGTCGCCACGGACGGCGCCGGCGGTGCGGTG
GTCACCGTCGAGCGGCTCACGGTGCTGCCGGTCAGCGCGGAGCAGGTACGCGAGAGCGCC
CGGTCGGCCGACGAGGAGGCCCTGTACCGGGTCGACTGGGTCCCCGTCCCTGTCTCCGCA
CCCGACCGGCACCCGAACACCGTTGGCGGGGCGCCCTCTTGGGTGGCGATCGGCGCGGAC
GCCCCTGCGACGCGGGCCGTTGCGGCCTCGTACCCCGATGTCGACGCGCTCGTCGCGGCG
TTGGACTCCGGGGCGGGTGTGCCGGAGGTCGCGCTGTTGTTCTGTGGCCCCGGTCGGGGC
GGTGCGGTCACGGACGAGGTGCGGCAGGGGACGTCCGCGCTGCTGGACGCCGTGCGGACG
TGGCTGGCGGACGACCGGTTCGACGCCTCGCGTCTGGTCGTCGTCACCCGCGGTGCCGTG
GCTGTGCTGCCCGGCGAGGGCGTGGACGATCTCGCGCAGGCCGCGCTGTGGGGTCTGGTG
CGCTCCGCGCAGTCCGAGAACCCGGGCCGTTTCCTGCTCCTCGACAGCGATACGGACGTT
CCCGAGGAGGCGGTGCGCCGTCTGGCGGCCTCCGGCGACGAGCAGGCCGCGCTGCGTGAA
GGAGCGCTGCTGACACCCCGGTTGGCACGCGCGTCCGTGCCGTCGGGGACGGAGGCCGAG
TCGTCAGCGGCCGGTGCCCCCTTCTCCTCGGAAGGGACCGTACTGGTCACCGGCGGTACC
GGGACTCTGGGCGGCTTGGTGGCCCGGCACCTCGTCGCGGAGCACGGTGTCCGGCATCTG
CTGCTGCTGAGCCGTCAGGGCGCGGACGCCCCGGGCGCCGGGGGCCTGGCGGACGAGTTG
GCCGCGTCGGGCGCCCGGGTGACGTTCGCCGCGTGTGACGCGTCGGACCGTGAGGCGCTG
GCCGGGGTGCTCGCGAGCGTTCCGGCGGACCGTCCGCTGACCGGTGTGGTGCACGCGGCC
GGCGCGCTGAGCGACGCCACGGTGGCGGCGCTCACCCCGGAGCACCTGGAGCGGGTGCTG
CGGCCCAAGGCCGACGCGGCCGCTCATCTGGACGAGCTGACCCGTGACCTGGACCTGTCG
GCGTTCGTGCTGTTCTCGTCCGCGGCCGGCGTGCTCGGCAACCCAGGGCAGGCCAACTAC
GCGGCTGCCAACACGTTCCTCGACGCGCTCGCCGAGCGGCGCCGGGCGCAGGGGCTGCCC
GCCGTGTCCGTCGCATGGGGTCTGTGGGCGCCGTCCAGCGCCATGCGGGCGCACCTCGGC
GAGCGGGACGAGGCCCGGATCGTGGGGTCCGGTGTGCTGCCCATGCCCGCCGAACAGGGC
CTGGCGCTGCTGGACGCCGCACTGCGCGCCGATCGGCCCTTGGTGGTGGCCGCACGGCTC
GATCCGTCGGCACTGCGCCGCCGTGCGCAGGACGGCACGCTGCCCGGCGTCCTGCGCGGG
ATCGTACGCGTGCCGGTGCGTCGCGCCACGGCGGACGGCACGGACGACGGCGGGTCGGCG
CTGCTGCGTCGTCTCGCGGGTCTGCAGGAGGCCGATCAGGAGCGCGAGTTGGCCGCGCTC
GTGCGCGGTGAGGCGGCGGCCGTGCTGGGTCACGCCGACCCGTCCTCGCTCGACCTCGCG
CAGCCGTTCAGGACGCTCGGCTTCGACTCGCTCACCGCGGTGCAGCTGCGCAACCGCCTC
GCGGCGGTGACCGGTCTGCGGCTGCCCGCGGGCCTGGTCTTCGACCATCCCTCTCCGGCC
GCGGTCGCCCGTCACCTGCGCACCGAGCTGACCGGAGCCGCGGAGTCGACCGTGGCACCC
GTGCCGGTCGCCGCCGCGGGCACCGACGAGCCGGTCGCGATCGTCGGCATGGCCTGCCGC
TTCCCCGGGGGCGTCCGCTCGCCGGAGGACCTCTGGCGCCTGGTCGTGGACGGCGGTGAC
GCGGTCTCGGACTTCCCGGCCGACCGCGGCTGGGACCTGGACGCGCTCTTCGACCCGGAC
CCGGACCACCCGGGCACCTCCTACGCCCGCCAGGGCGGATTCCTGCTCGACGCCGCCGAC
TTCGACGCCGGATTCTTCGGCATCTCCCCACGCGAAGCCCTCTCCATGGACCCGCAGCAG
CGGCTGCTCCTGGAGACCTCGTGGGAGGTCTTCGAGCGGGCCGGCATCGACCCGGCGACG
CTCAAGGGCAGCCGTACGGGCGTCTTCGCCGGAGCCATGTACCAGGAGTACGCAGCGAAC
GTCGCCCCGGAGACCGTGGAGGGGCACTTCCTGAGTGGCACCTCCTCCAGCGTTGTGTCG
GGCCGCGTCTCCTACACCTTCGGTCTGGAGGGGCCCGCAGTCACCATCGACACCGCCTGC
TCCTCCTCCCTGGTCGCGCTGCACCTGGCCGCACAGGCGCTGCGCAACGGCGAGTGCGAG
CTGGCGCTCGCCGGCGGTGTCGCGGTGATGACCACGCCGGTGCTCTTCACCGAGTTCAGC
CGGCAGCGGGGACTGGCCCCGGACAGCCGCTGCAAGCCCTTCGCCGCGGCGGCGGACGGC
ACGGCCTGGTCCGAGGGCGTGGGCGTGCTGCTGGTGGAGCGGCTGTCCGACGCCCTCCGC
AACGGCCACCGGGTGCTCGCAGTGGTCCGCGGCTCCGCCGTGAACCAGGACGGCGCCAGC
AACGGCCTCACCGCCCCCAACGGCCCCTCGCAGCAGCGGGTGATCCGCCAGGCCCTGGCC
AACGCCCGCCTGACCCCGGCCGACGTCGACGCCGTCGAGGCGCACGGCACCGGCACCACC
CTGGGCGACCCGATCGAGGCCGACGCCCTGCTGGCCACCTACGGACAGGACCGCCCCGAG
GACCGCCCGCTGTGGCTGGGCTCGGTGAAGTCCAACATCGGGCACACCCAGGCCGCCGCC
GGCATGGCCGGGATCATCAAGACGGTCATGGCCATGCGCCACGGGCTGCTCCCCCGCACC
CTGCACCTGGACGAGCCGACCCCGCACGTCGACTGGACCTCCGGCCGTGTCGCCCTGTTG
ACCGAGCCCGTCGCCTGGCCCGTGTCCGACCGTCCGCGCCGGGCGGGTGTCTCCTCCTTC
GGCGCCAGCGGCACCAACGCCCACGTCATCCTCGAACAGGCGCTGCACACGACCGCTGCG
AACCAGGACACACCGTCCGACGCCGGCTCGGGCGCACTGCCCTGGCTGGTCTCGGGCCGC
ACGGCCGAGGCACTGCGCGAGCAGGCCGCGCGTCTGCGTTCCTTCGTGCAGTCGGACGAG
GCCGTCGAGCTGGAGCCGTCGGCGGTCGCGGGTGCCCTCGCCGCCGAGCGCGCCACGTTC
GGGCACCGCGCCGTCGTCCTGGGCTCCGACCGCCCCGACTTCACGGACGCCCTGACCGCC
CTCGCCGAGGGCACGCCCCACCCCGGCGTCGTCCAGGCCACGGCCCTGGAGGTGACACGT
ACGGTGTTCGTGTTTCCGGGTCAGGGTTCGCAGTGGACCGGGATGGGACGCGAACTCCTC
GACAGCTCGCCCGAGTTCGCCGCGTACATCGCCGAGTGCGAGACCGCGCTCAACGACTTC
GTGGACTGGTCGCTCACCGACGTCCTGCGCGGCACCGAAGGAGCCCCCGGCTACGACCGC
GTCGACGTCGTCCAGCCCGCCCTCTTCGCCGTCATGGTCAGCCTCGCCCGCCTCTGGCAA
CACCACGGCATCCACCCCGACGCCGTCATCGGCCACTCCCAAGGCGAAATCGCCGCCGCC
CACATCGCCGGAGCCCTCACCCTCAACGACGCCGCCCGCATCGTCGCCCTACGCTCCCAA
GCCCTCCTCCCCCTCGCCGGCCTCGGCGGCATGACCTCCCTCGCCCTTCCCCACCACCAA
GCCCACGAACTCATCCAGCCCTGGGGCCAAGACCTCTCCATCGCCTCCGTCAACGGACCC
CACTCCACCGTCGTCTCCGGCACCACCCACGCCCTCGACGAACTACACACCACCTGCAAC
ACCCAAGGAGTTCGGGCCCGCCGCATCCCCGTCGACTACGCCTCCCACTCCGCCCAGGTC
GAAAGCATCCGCGACACCGTCCTCCAAGCAGCCACCGGCATCAACCCACAGCCGACAGCC
GTCCCCCTCTATTCGACGGTCACCGGCCAACCCATCAACGGCACCCAGCTCGACGCCGAC
TACTGGTACACCAACCTCCGCCACACCGTCCGCTTCGAGGAGACGGTCCGCGCTCTGCTC
GGCGACGATCACAACGCGTTCATCGAGGCCACCGCGCACCCGGTCCTCACCATGGCCGTC
GAGGAGACCGTGGGCGCGGTGGAGCGCGAAGCCGTGGTCGTCGGGACGCTACGGCGCGAC
GAAGGCGGGATCGACCGTTTCCGGACGTCGCTCGCCATGGCGTGGGTGCGCGGGGTGGGC
GTCGACTGGGTCGGCATGCTGGGCGGGCGCGGTGCGCGTCCGGTGGATCTGCCCACGTAC
GCCTTCCAGCGCGAACGGTACTGGCTGGAACCCGCGACCCGGACGTCCGGTGACGCGTCC
TCGCTGGGCCTGGAGGGTGCCGGTCATCCCCTGCTCGGCGCGGCTCTCCGGCTCGCCGGC
GAGGACGGGGTCCTCCTGACCGGGCGGCTGTCCCGGGAGGCCCTGCCGTGGCTGGCGGAC
CACGCGGTCGCCGGGACCGTCCTGCTGCCGGGTGCGGCCTTCGTCGAGCTGGCGCTGCGT
GCCGGGGACGAGGCCGGCTGTGATCTGGTCGAGGAGCTCACTCTGGAGGCACCGCTCCTC
CTGCCGGAACGCGGGGGCGTACGGCTCCAACTCGTGCTCGGGGTACCCGACGCGCAGGGG
CGGCGCGAACTGGGCGTGTACGCGCGGCCGGACGGCGACGGCGACGGCGACGGCGACTAC
GGCGGTGAGGCCCCGTGGACGCGGCATGCCCGTGCCGTGCTCGCCGTGGCGGGCGACGCC
GACCGTGCCGACGTCGCGCTTCCCGGCGCGGTGTGGCCACCCTCCGGGGCCGAGGCCCTG
CCCGTGGCCGACTTCTACGCGGACGCCGCGGACGCCGGTTACGGGTACGGGCCCGCCTTC
CAGGGGCTGAGGGCGGCCTGGCGGCTCGGCGAGGAGATGTTCGCCGAGGTCGCGCTGCCG
GAGCAGGTGCGGGAGGAGGCTTCCGCGTACGGGATCCATCCCGCGCTGCTCGACGCGGCC
CTGCACCCGGCCCTGCTCGACCAGGTGGGCGGTGACGCTCAGGTGCGGCTGCCGTTCGTG
TGGAGCGGGGTCATGCTGGACGCGGTGGGCGCGGGCGTCCTCCGTGTCCGCATCTCCCCC
TCCCGTGCGGACTCCCCGTCCGGTGCCGATGGGCTGGCGGTGTCGCTCACCGATCCCGAG
GGGCACCCGGTCGCCACCGTCGGCGCGTTGGTGTCGCGTCCGCTCTCCGCCGACCAGGTG
CGGCAGACGTCGGGCAAGGCCCTGGAGTCCCTGTACCGCGTGGCATGGGTGGGTCTGCCG
GCCCTCGCTGCCAACTCGACGACGCCCGTTCCGCTGGACGAGGTGTCCGACGACTCGGCC
GAGGTTCCCGAGACCGTCCTGCTGTCCTGCGCCGACGCGACAGCCGACGCTGCCGACGCC
GCATCCGGCATCGCCGACGTCGTGGATGGGGTGCGCCGCGCCGCCCATGAGCTGCTGCAC
AGGGTGCAGGCCTGGCTCAGCGACGCCCGGTTCGCTTCCTCACGCCTGGTCGTGCTCACC
CGGGGCGCGGTGGCCGCGTCGCCCGAGGACCGGACGACCGACCTGGTGACCGCTCCGCTG
TGGGGGCTGATCCGGTCGGCGCAGGCGGAGAACCCGGGGCGGTTCGTGCTGCTCGACACC
GACGGCACGGAGGCATCGGCTGCCGTGCTCGCCGGGGCCGCCGCGAGCGACGAGAGTCAA
CTCGCCCTCCGCGACGGGGCGGTGCTGGTCCCCCGGCTCGTGCGCGGTGCGGTGTCCGGC
GCGCTCGCCCTGCCGGCCGACGGCTCCGACTGGCGGGTGGACTCGCGCAGTCCGGGCACG
CTGGAGGGTCTGTCGGTGCTTCCGGGCACCGCGGCCGCACAGCCGTTGGAACCGGGCCGG
ATACGGGTCGCCGTCCGTGCCGCCGGGCTGAACTTCCGCGACGTCCTGATCGCGCTCGGC
ATGTATCCCGGTGAGGCGACGATGGGCAGCGAGGGCGCCGGGGTCGTCGTCGAAGTGGCG
CCGGACGTGACGGAGTTCGCGGTCGGCGACCGGATCGTGGGGCTGATCCCCGAGTCGTTC
GGTCCGTTCGCGGTGGTCGATCACCGTACGGTCGTGCGGATGCCGGAGGGGTGGTCGTTC
GAGCAGGCCGCCGCCGTGCCGATCGTCTTCCTGACCGCCTACTACGGCCTCCGCGACCTC
GCCGACCTGCGGGCCGGGGAGTCGGTCCTCATCCACGCCGCTGCGGGCGGCGTCGGCATG
GCCGCCGTCCAACTCGCCCGCCACTGGGGCGCCACCGTCCACGCCACCGCCAGTCCCCAC
AAGTGGGACACCCTGCGCGCCCTGGGCCTGGACGACGACCACATCGCCTCCTCCCGCACC
CTCGACTTCAGCGACCAGTTCGACGAAGTCGACGTCGTCCTCAACTCCCTCACCGGCGAA
TACATCGACGCCTCCCTGCACCTCCTGCGCGACGGCGGCCGCTTCATCGAGATGGGGAGG
ACGGACGTACGGGACGTGTCCGGGGTGTTCTACCGGGCCTTCGTACTGGCCGAGGCGGGG
CCCGAGCGTATCGGCGAGATGCTGGGTGAGGTCGTACGGCTCCTGGAGACGGGCGCGCTG
ACGCACCTGCCGCTGGACGTGCGTGATGTCCGCCAGGCCCCGGAAACCTTCCGGCACATG
AGCCAGGCCCGCCACATCGGAAAGATCGTGCTGCGGATACCGCAGTCCCCGGACGCTCGG
GGCACCGTCCTGATCACCGGTGGCACCGGCACCCTCGGCGCGCTCACCGCCCGACACCTC
GTCACCACCCACGGCACCCGCCGCCTCCTCCTCACCAGCCGCCAGGGCATGGCAGCACCC
GGCGCCGCCCCACTCGCGGACGAGCTGCGGGACCTGGGCGCGCACGTCACCATCGCCGCC
TGCGACACCGCCGACCGCACCGCACTGACCCACCTGCTGGACTCGATTCCGGCCGAGCAC
CCCCTCACGGCCGTCATCCACTGCGCCGGCGCCCTCGACGACGGCACCGTGCCGACGCTC
ACCCCGGAGCGCTTCGAGGCGGTGCTGCGTCCCAAGGTCGACGCGGCGTGGAACCTGCAC
GACCTCACCCGGCACCTGGACCTGTCGGCCTTCGTCCTCTTCTCCTCCGCCGCCGGCGTG
CTCGGCGGGGCGGGGCAGGCCAACTACGCCACCGCCAACACCTTCCTCGACGCCCTCGCC
CACCACCGCCACGCCCACGGACTGCCCGCCACCAGCCTGACCTGGGGTCACTGGGAGCAG
GCCAGCGGCATGACCGGGCACCTGGACCGGACCGACCTCGCGCGGATCGGCCGTACGGGG
CTGCTACCCATGTCCCCGGCATACGGGCTGGCCCTGTTCGACGCGGCGCTGCGGGAGTCG
GATGCCGTGCTGGTGCCCGTGCGGCTCGACACGGGTGCGTTGCGCGAGCAGCACGCCGGC
GGGGCGCTGCCCCCGGTCTTCCGCGAGCTGGTGCGGGGGCCCGCACGGCGTACGGCCGCG
ACGGGGGGTGCCGCGGACCAGTCGGCGCTGGCTCGGACACTGGCCGGCCGTTCCACCACC
GAGCAGAAGGCGATCCTCCTCGACCTCGTCCGCACCCACATCGCCACCGTCCTCGGCCAC
ACCACCCCCGACACCATCAACCCCGACCAGCCCTTCAAAGACCTCGGCTTCGACTCCCTC
ACCAGCGTCGAACTCCGCAACCGCCTCACCACCGCCACCGGCCTCAAACTCCCCGCCACC
CTCACCTTCGACCACCCCACCCCCCACGCCCTCACCCACCACCTCCACCAACAAACCACC
GGCACCACCCACCCCACGCCGATCAACACACCACCCACCACCGCCCCCGCACCCGACGAA
CCCCTCGCCATCGTCAGCATGGCCTGCCGCTTCCCCGGCGGCATCGAGTCGCCCGACGAC
CTGTGGCAGTACGTCGTCCAGGGCCGTGATGCCGTCTCCGACTTCCCGGTCGACCGCGGC
TGGGACCTGGAGAGGCTGTACGACCCGGATCCCGAACGGTCCGGAACGTCGTACACGCGA
TCCGGTTCCTTCCTCTACGACGCAGCCGACTTCGACGCGCAGTTGTTCGGCATCTCGCCC
CGCGAGGCCCTGGCGATGGATCCGCAGCAGCGCCTGCTGCTGGAGACCTCCTGGGAAGTC
CTGGAACGGGCCGGCATCAACCCGCGCAGTCTGCGCGGGAGTCAGACCGGTGTCTTCGTC
GGTGCGGTCAACACGGGCTACGGCACGGGGCTCCCGCACACGCCCGAGGACATCGAGGGC
TATCTGGGGACGGGCACGTCGTCCAGTGTCGCGTCGGGGCGCGTGGCCTACACCTTCGGT
CTCGAAGGGCCGGCCGTCACGGTCGACACGGCTTGCTCCTCGTCGCTGGTGGCGCTCCAT
CTGGCCGCACAGGCGCTGCGCAACGGCGAGTGCACGATGGCCTTGGCGAGCGGGGTCGCC
GTCATGGCGACGCCGTTGGAGTTCGTGGAGTTCAGCAGGCAGCGGGTGCTCTCGGCGGAC
GGCCGCTGCAAGGCGTTCGCGGCGGCGGCCGACGGCACCGGTTTCTCCGAGGGCGTGGGC
GTGCTGCTGGTGGAGCGCCTGTCCGACGCCCGCCGCAACGGCCACCAGGTGCTCGCCGTG
GTCCGCGGCTCGGCTGTGAACCAGGACGGCGCCAGCAACGGCCTCACCGCACCCAACGGC
CCTTCGCAGCAACGGGTGATCCGCCAGGCCCTCGCCAACGCCCGCCTCACCCCCGCCGAC
GTCGACGCCGTCGAGGCGCACGGCACCGGAACCGCGCTGGGCGACCCGATCGAAGCCCAA
GCCCTGCTCGCCACCTACGGTCAGGACCGGCCCACGGAGCAGCCGTTGTGGCTGGGCTCG
ATCAAGTCCAACATCGGCCACACCCAGGCCGCCGCCGGCATGGCCGGCATCATCAAGATG
GTCATGGCCATGCGCCACGGCATCCTCCCCCGCACCCTCCACGTCGACGAGCCGTCCCCG
CACATCGACTGGACCGCCGGCGCCGTCTCACTGCTCACCGAACCGGTGGACTGGCAGGCC
GGTGACCGCCCCCGACGCGCCGGCGTCTCCTCCTTCGGCATCAGCGGAACCAACGCCCAC
GTCATCCTCGAACACGTCGCAGAGGTGCCGGAGCTGTCGCCCGTGGACGAGGACTCCACC
ATGCCGTTGGTGTTGTCCGGCCATACCCCCGAGGCGCTGCGGACGCAGGCCGATCGGCTC
CACGCCCATCTCACGGGCCGCCCTGAGCTGCCTGTTGCGCAGGTTGCCGCGTCCCTCGTC
GCCACGCGTGCGGCACTCGACCATCGCGGGGCGGTCCTCGCCGAGGACCGGGAGGGGTTC
CTCGAAGGGCTGCACGCCCTCGCGCAGGGCCGGCCCTCGCCGCAAGTCGTCACCGCGACC
ACCGAGAACCGCGGCAAAACCGTCTTCGTCTTCCCCGGACAGGGCTCACAGTGGCCCGGC
ATGGGACGCGAACTCCTCGACACCTCACCCGTCTTCGCCACCCACATCACCGAATGCGAA
GCCGCCCTCACCCCGTACGTCGACTGGTCCCTGACCGACGTACTACGCCAGGGCGAACCC
CTGGACCGCATCGAAATACTCCAACCGGTCCTCTTCGCCCTCATGGTCTCCCTCGCCCGC
CTCTGGCAACACCACGGCATCCACCCCGACGCCGTCACCGGCCACTCCCAAGGCGAAATC
GCCGCCGCCCACATCGCCGGAGCCCTCACCCTCGACGACGCCACCCGCATCGTCGTCCTA
CGCTCCCAACTCTTCGCCGACCACCTCACCGGACACGGCGCCATCGCCTCCCTCACCCTC
CCCGCCACCCAAGTAACACACCAGCTCACCCAGTACGACGGACGCCTCACCATCGCCGGC
ATCAACAGCCCCACCACCTGCACCGTCGCCGGACCCCACACCGACCTCACCACCCTCACC
CACTGGGCCCGCCAACAAGGCGCCCGCGCCCGCATCATCGACACCACCGTCGCCTCCCAC
AGCCCCCACGTCGAACCCCTCCACGACGACCTGATCCACCTCCTCGCCGACATCACCCCA
CAACCCGGCACCACCCCCATCTACTCCACCGTCACCACCGAACCCATCGACGGCACCCAG
CTCACCGCCGAGTACTGGTACGACAACTGCCGCCACCCCGTCCGCTTCCACGACACCCTG
CACACCCTCACCACCCACGGCCACACCCACTACCTCGAAATCAGCCCCCACCCCGTCCTC
ATCCCCGCCATCACCGAAACCCACCCCACCGCCACCACCATCCCCACCCTCCACCGCAAC
CAAGGCACCACCACCGACCTCCACACCAGCCTCGCCCACGCCTGGACCACCGGACTCCCC
ACCACCTGGCACACCCCCCACCACCACCTCGACCTCCCCACCTACCCCTTCCAACGCCAG
CGCTACTGGCTGGAGTCGGCGCCGCTCTCCGCCTCGCAGGGTCCTGCCGGCCCTGCCGAT
GACACGGATGCGCGCTTCTGGGAGGCAGTGGAGCGGGAAGACCTGGAGGCGCTCTCCTCG
ACGCTGAGCCTCGACGGCAACGGTGAGGCGCTGTCCTGGAGTGCGGTGCTTCCCTCCTTG
TCCAGCTGGCGGCGTCAGCAGCGTGAACAGGCGACCCTCGACAGCTGGCGCTACCGGATC
TCCTGGAAGCGCATTACCGTCCCGAACCTGCCTACGTTGACCGGCACTTGGCTGCTGGTG
ACAGGTCCGGAGCGGTCCGGTGAGGCGTGGAGCGCGGTCGTCGCCCGGGCCATGGCATCG
CGCGGGGCGCAGGTCAGCACGCTGTCCGTCGACGCCGCCGGGCTCGACCGGGAGACGCTC
CGCGAGCGCATCCGCGAGCACCTCGCGGACAGTGAGCAGCCCGTCGGGGTGCTGTCCCTG
CTCGCGTGCGGTGCCGGAACCGCGGAGTCGGGACGTCCCGGGGTTCCGTCGGCTCTGGCG
ACGACCGTCGCGCTGGTGCAGGCGCTGGGCGACGCAGGAGTCGACGCGCCGCTGTGGTGC
GTGACGAGCGGGGCGGTGTCCGTGTCCGCCACCGAGTACGCGCTGCCGGAGCAGGCAGCG
GTGGCCGGTCTGGGACGCGTGGTGGCGTTGGAACAGCCACAGCGGTGGGGCGGAACGATC
GACCTGCCGGGACAGCTCGGGGATGTCGACGACCAGGTGGCCGTCCGGCTCGTCGGGGTG
CTGGCGGAGCACGGCGACGAGGACCAGCTCGCGGTGCGGGCGTCGGGCGTGTTCGGACGC
CGGCTGGTACGGGCGCCCCTGGGGGCCGCTGCGCCGGTGCGATCGTGGAAGCCGCGCGGC
ACGGTGCTCGTCACCGGAGGAACCGGGGGTGTGGGCGGCCGCGTCGCGCGGTGGCTCGCC
ACGTCCGGCGCCGAGCACCTGCTGCTCGTCAGCCGGAGCGGACCCGAGGCGCCCGGAGCC
GCCGAACTCGAAGCGGACCTGGCGGCGTCGGGGGCGCGCGTCAGCGTCGTCGCGTGTGAC
GTGGCGGACCGGGACGCGGTCGAGCGGCTGCTGTCCTCGGTGCCCGACGCGCATCCGCTG
ACCGCGGTGGTGCACGCCGCGGGCGTGCCGCAGCAGAGCGCGGTGGAGGAGCTGACCCCC
GCGGAGGTGGAGGAGATCCTCTCCGCGAAGGTGCTCGGCGCCCGGCACCTGGACGAGCTG
CTGGCCGACGCCCCGCTCGACGCGTTCGTGCTCTTCTCCTCGAACGCGGGTGTGTGGGGC
AGCGGCGGCCACAGCGCCTACGCGGCGGCGAACGCCTACCTGGACGCGCTCGCCGAGCGG
CGCCGGGCTCACGGGCGTACGGCGACGTCGGTGGCGTGGGGTGCCTGGGCCGCGGGCGGA
ATGATGGCCGCGGAGGGCGCTGCCGCGTACATGGGCCGGCGTGGCGTGCTGGACATGGAG
CCGGAGCGGGCCGTCGCCGCGCTCGTGGCCGCGGTCGAGCATGACGAGACGTTCGTGGCG
GTTGCCCACATGGACTGGGAACGCTTCGTCCTCGGGTTCACGTCACTGCGTCCCAGCCCC
CTGCTGGACGACATCCCGGAAGCGCGCCGCGCGCTCGCCGAGCTGGCCGAGGAGACGGAG
AGCGGCTCCGACGCCTCCACGCTGGCGCGGGAACTGGCCGACATGTCCCCGGACGACCGG
CGGGCCGCCCTGCTGGACCTGGTCCAGTCGAACGCCGCGGCCGTGCTCGGCCACACCGGT
GGTGCGGCCGTCGACGCGCACCGCGCGTTCAAGGAGCTCGGCTTCGACTCCCTCACCGCG
GTCCAGTTGCGCAACCGCCTCAACGCTGCCACGGGACTGCGGGTGCCGGCCACGCTCGTC
TTCGACCACCCCACCCCGGCCGCGGTCGCCGCGTACGTGGAGGCCCAGCTGCTGCCCGAT
GTCTCCGGTGCCCGGCTGCCGGTCCTGGAGGAGATCGACCGACTGGACGCGTCGCTGTCC
GACGGTCCGGCCGACGCCGACCTGCTGCACGCCGTGCAGGACCGGCTCCAGGAGATGCTC
TGGAAGCTCGCGGACAGGTCCGCGGCGTCCGGCGGGACGGCCTCGCCGTCCGGCGACCCG
GACGAACGAGGCGCGACGGACGGCGACTTCGCCTCGGCCACGGCCGACGACATGTTCGAC
CTCATCGACCGGGACCTCGGACTGTCCTGA
[3] KS34..410
[3] AT565..876
[3] ethylmalonyl-CoA754..758
[3] DH920..1085
[3] KR1414..1592
[3] ACP1693..1767
[4] KS1789..2164
[4] AT2322..2640
[4] methylmalonyl-CoA2513..2517
[4] DH2689..2863
[4] ER3179..3471
[4] KR3481..3661
[4] ACP3766..3836
[5] KS3860..4236
[5] AT4388..4699
[5] ethylmalonyl-CoA4577..4581
[5] KR5020..5199
[5] ACP5304..5374
[3] KS100..1230
[3] AT1693..2628
[3] ethylmalonyl-CoA2260..2274
[3] DH2758..3255
[3] KR4240..4776
[3] ACP5077..5301
[4] KS5365..6492
[4] AT6964..7920
[4] methylmalonyl-CoA7537..7551
[4] DH8065..8589
[4] ER9535..10413
[4] KR10441..10983
[4] ACP11296..11508
[5] KS11578..12708
[5] AT13162..14097
[5] ethylmalonyl-CoA13729..13743
[5] KR15058..15597
[5] ACP15910..16122

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [555-685]  G3DSA:3.40.366.10 [754-866]  G3DSA:3.40.366.10 [2318-2445]  G3DSA:3.40.366.10 [2513-2629]  G3DSA:3.40.366.10 [4378-4508]  G3DSA:3.40.366.10 [4577-4689]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [3306-3327]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [1725-1740]  PS00012 [3794-3809]  PS00012 [5332-5347]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1693-1767]  PS50075 [3766-3836]  PS50075 [5304-5374]  PS50075
PS50075   ACP_DOMAIN
 [1695-1771]  1.29999999999998e-69 G3DSA:1.10.1200.10 [3766-3839]  1.29999999999998e-69 G3DSA:1.10.1200.10 [5302-5377]  1.29999999999998e-69 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1701-1766]  1.2e-11 PF00550 [3769-3835]  7.09999999999999e-13 PF00550 [5309-5373]  2.80000000000001e-12 PF00550
PF00550   PP-binding
 [1690-1806]  6.19998763505952e-28 SSF47336 [3759-3876]  6.69999687625999e-29 SSF47336 [5296-5391]  1.60000240695997e-23 SSF47336
SSF47336   ACP_like
IPR011032 GroES-like (Domain)
 [3170-3313]  3.60000433965927e-30 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [3317-3402]  7.5e-12 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [3198-3254]  2.5e-07 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1412-1590]  7.20000000000003e-63 PF08659 [3481-3660]  3.09999999999998e-63 PF08659 [5020-5198]  2.29999999999998e-64 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-284]  4.30000000000003e-95 PF00109 [1789-2038]  2.30000000000004e-98 PF00109 [3860-4110]  1.39999999999997e-94 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-410]  3.09999999999998e-50 PF02801 [2046-2164]  1.2e-49 PF02801 [4118-4236]  2.29999999999998e-50 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [565-876]  1.5e-90 PF00698 [2322-2640]  3.90000000000001e-105 PF00698 [4388-4699]  2.90000000000003e-90 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  5.59999999999999e-13 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [563-852]  5.89998809405682e-71 SSF52151 [2320-2624]  4.99996518094122e-67 SSF52151 [4386-4675]  3.19999899046355e-71 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [688-753]  2.49999811956465e-11 SSF55048 [2447-2512]  3.29999802154459e-16 SSF55048 [4511-4576]  1.59999889349252e-11 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [33-295]  G3DSA:3.40.47.10 [296-461]  G3DSA:3.40.47.10 [1792-2050]  G3DSA:3.40.47.10 [2051-2214]  G3DSA:3.40.47.10 [3863-4122]  G3DSA:3.40.47.10 [4123-4287]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-408]  2.0000139277205e-105 SSF53901 [1782-2162]  7.6999848053369e-105 SSF53901 [3852-4288]  8.39998014024973e-104 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1411-1615]  1.69999999999998e-111 G3DSA:3.40.50.720 [3314-3400]  5.20000000000001e-18 G3DSA:3.40.50.720 [3480-3682]  1.69999999999998e-111 G3DSA:3.40.50.720 [5020-5239]  1.69999999999998e-111 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606 [1951-1967]  PS00606 [4023-4039]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [567-858]  7.00003808422647e-116 SM00827 [2324-2621]  1.3000049540733e-122 SM00827 [4390-4681]  4.40002866058555e-118 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1698-1770]  1.39999892049878e-32 SM00823 [3767-3839]  4.30000170645869e-37 SM00823 [5305-5377]  2.69998997787809e-35 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [920-1085]  5.40001756046195e-62 SM00826 [2689-2863]  1.69998802370953e-84 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-462]  SM00825 [1792-2216]  SM00825 [3862-4288]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1412-1592]  3.1999989904635e-61 SM00822 [3481-3661]  2.39999798157265e-62 SM00822 [5020-5199]  2.9000035467798e-54 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [3179-3471]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit