close all open/close all

CDS information : Lasal2_00220


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction76,171 / 80,106 / + [in whole cluster]
76,171 / 80,106 / + [in contig]
Location76171..80106 [in whole cluster]
76171..80106 [in contig]
TypeCDS
Length3,936 bp (1,311 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)lasalocid modular polyketide synthase
Gene
Gene (GenBank)lasAVII
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase modules and related proteins
Reference
ACC
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)
Related Reference
ACC
B6ZK70
NITE
Lasal_00190
PmId
[19129623] Identification of a gene cluster of polyether antibiotic lasalocid from Streptomyces lasaliensis. (Biosci Biotechnol Biochem. , 2009)

close this sectionPKS/NRPS Module

11 malonyl-CoA
KS35..411
AT566..868
ACP937..1007
TE1105..1307

close this sectionSequence

selected fasta
>polyketide synthase [lasalocid modular polyketide synthase]
MTTSPEKIVEALRASLSENERLRRQNQQLTTASREPVAIVGMACRFPGGVESPEQLWRLL
TEGRDAVADFPSDRGWDLDSLYDPDPDHPGTSYTSQGGFLYDAGQFDPLLFGISPREALA
MDPQQRLLLETSWEVFERAGIDPSSLGGTRTGVFAGAIASGYAIGLPEFPEGVQGYVGTG
TSASVLSGRISYAFGLEGPAVTVDTACSSSLVALHLACQALRNGECSLALAGGVTVMAVP
GLFTEFSRQRGLAPDGRCKAFAAAADGTGFSEGVGVLLVERLSDARRNGHQVLAVVRGSA
VNQDGASNGLTAPNGPSQQRVIRQALANARLTPADVDAVEAHGTGTTLGDPIEAQALLAT
YGQNRTEDQPLWLGSVKSNIGHTQAAAGVAGVIKMVMALRHEVLPQTLHVDAPSPHIDWA
SGHVSLLTEELKWPGTDRPRRAGVSSFGISGTNAHVILEAAPPETPPADDEPERAAGPVP
WVLSARTRKALQSQAARLLTFTEETPDVSVAAVSSALLGTRAALDHRAVVLASDRVEFSR
RLHALASGRPASGVTTGSVRSGRLAFMFTGQGSQRLGMGHELYDTEPAFAAALEEAFAAL
DPHLPQPLRDIIFGDDPELLQQTQYAQPALFAVETALYRLLTDTYGLRPDYLLGHSIGEL
TAAHAAGVLTLPDAARLVTARGHLMQTAPTGGTMIAIQATEDEITEHLTPGVAIAALNSP
SSTVISGDTAEAEAIADRFRALGRKTSRLKVSHAFHSPHMDPVLDDFRQIAATLDYHPAR
IPVISNTTGQPAENLTSPDYWTQHIRRPVRFTDSLHHLTQQGVTTFLELGPDATLAMLAD
AHATAVLRRNSSEPQALRTALAELWVHGVPVAWPHSTDRRVDLPTYAFDHQHYWLDAAPG
TSATSVRPSVPVEAADAPPTLADRFEGLGAGERTSMAEELVRETVAVVLGFADPEDVDVS
TPFIKLGIDSLTAVELRRRLGGYTGLEIPAVVVFEHPTTHDLAEYLIEAMSAPPGATPDG
ASGAPSGVRATAAVDSLSDLFVRACGRGEFAEAHRLALGLAEYRPTFAGELDGARSPDVV
PLRRGTASPAVVCFPSFVWKPDFQQYLSLARELTEDRDVAVSGLPGFRPGEPLPASAEAL
ARALAAVVRRVAGGRRCVLLGHSSGGYVAAAVAAQLEEAGEAPAGLVLVDTPWWGSAGGL
GSQEWLPVINEMLLARGAAAGAEDSDAGDAWVTARAKYFSLDFAIAPRDVRTLLLRPAEP
LAGSAADAGWRAEWRPGTTVVEVPGNHFSMLDSAHAQACARAVEGWLATLG
selected fasta
>polyketide synthase [lasalocid modular polyketide synthase]
ATGACCACATCGCCAGAGAAGATCGTCGAGGCGCTGCGTGCATCGCTGTCGGAGAACGAG
CGGCTGCGACGCCAGAACCAGCAGCTCACCACGGCGTCCCGGGAGCCGGTGGCCATCGTC
GGCATGGCCTGCCGGTTCCCCGGCGGGGTGGAGAGCCCCGAGCAGCTGTGGCGGCTGCTG
ACCGAGGGCCGGGACGCCGTCGCGGACTTCCCGAGCGACCGCGGCTGGGACCTGGACTCC
CTCTACGACCCGGATCCCGACCACCCGGGGACGTCGTACACGAGCCAGGGCGGATTCCTG
TACGACGCGGGGCAGTTCGACCCGCTGCTGTTCGGCATCTCGCCCCGCGAGGCCCTGGCG
ATGGACCCCCAGCAGCGGCTGCTGCTGGAGACCTCCTGGGAGGTGTTCGAACGCGCCGGC
ATCGACCCGAGTTCGCTCGGCGGGACCCGGACCGGTGTGTTCGCCGGCGCCATCGCCTCC
GGCTACGCGATCGGTCTGCCGGAGTTCCCCGAGGGTGTCCAGGGGTACGTCGGCACCGGC
ACGTCGGCGAGCGTGCTGTCCGGGCGGATCTCCTACGCCTTCGGTCTCGAGGGCCCTGCC
GTCACCGTCGACACCGCCTGCTCCTCCTCCCTGGTCGCCCTGCACCTGGCCTGCCAGGCC
CTGCGCAACGGCGAGTGCTCACTCGCGCTGGCCGGTGGCGTGACGGTCATGGCCGTACCG
GGTCTGTTCACCGAGTTCAGCAGGCAGCGGGGCCTCGCACCCGACGGCCGCTGCAAGGCC
TTCGCCGCGGCGGCCGACGGCACGGGCTTCTCCGAAGGCGTGGGCGTCCTGCTGGTGGAG
CGGCTGTCTGACGCCCGCCGCAACGGCCACCAGGTGCTCGCCGTCGTCCGCGGCTCCGCC
GTCAACCAGGACGGCGCCAGCAACGGCCTCACCGCACCCAACGGCCCTTCGCAGCAACGC
GTGATCCGCCAGGCCCTCGCCAACGCCCGCCTCACCCCCGCCGACGTCGACGCCGTCGAG
GCGCACGGCACCGGAACCACGCTCGGCGACCCCATCGAAGCCCAAGCCCTCCTCGCCACC
TACGGGCAGAACCGCACGGAGGACCAGCCGCTGTGGCTCGGCTCGGTGAAGTCCAACATC
GGCCACACCCAGGCCGCCGCCGGTGTCGCGGGCGTCATCAAGATGGTCATGGCGCTGCGC
CACGAGGTACTGCCACAGACACTGCACGTCGACGCGCCCTCACCCCACATCGACTGGGCG
TCGGGCCACGTCTCCCTCCTCACCGAGGAACTGAAGTGGCCGGGGACGGACCGGCCGCGC
CGGGCCGGTGTGTCCTCCTTCGGCATCAGCGGCACCAACGCCCACGTCATCCTTGAAGCC
GCCCCGCCGGAGACCCCGCCCGCCGATGACGAGCCGGAGCGGGCGGCCGGACCGGTGCCG
TGGGTCCTCTCCGCCAGGACCAGGAAGGCCCTCCAGTCCCAGGCGGCCCGGTTGCTCACC
TTCACCGAGGAGACCCCGGACGTCTCCGTCGCCGCCGTGTCCTCCGCGCTGCTCGGCACG
CGTGCCGCCCTCGACCACCGGGCCGTCGTCCTGGCCTCGGACCGTGTCGAATTCTCACGA
CGCCTGCACGCACTGGCGTCCGGCAGGCCCGCGAGCGGAGTGACCACCGGGAGCGTGCGG
TCGGGGCGGCTGGCGTTCATGTTCACCGGCCAGGGCTCCCAACGCCTCGGCATGGGCCAC
GAGCTCTACGACACCGAACCCGCCTTCGCCGCAGCACTGGAAGAAGCCTTCGCAGCACTG
GACCCACACCTGCCACAGCCACTGCGCGACATCATCTTCGGCGACGACCCCGAGCTACTG
CAGCAAACCCAGTACGCACAACCCGCGCTGTTCGCCGTCGAGACCGCCCTGTACCGGCTC
CTCACCGACACCTACGGCCTGCGCCCCGACTACCTCCTCGGCCACTCCATCGGAGAACTC
ACCGCCGCCCACGCCGCCGGCGTCCTCACCCTGCCCGACGCCGCACGCCTGGTCACCGCC
CGCGGACACCTCATGCAAACCGCACCCACCGGCGGAACCATGATCGCCATCCAAGCCACG
GAAGACGAAATCACCGAACACCTGACCCCCGGGGTGGCTATCGCCGCCCTCAACTCCCCC
AGCAGCACAGTCATATCGGGTGACACCGCCGAGGCAGAAGCCATCGCGGACCGCTTCCGC
GCCCTCGGCCGCAAGACCAGCCGACTGAAGGTCTCCCACGCCTTCCACTCCCCCCACATG
GACCCCGTCCTCGACGACTTCCGGCAGATCGCCGCCACCCTCGACTACCACCCCGCCCGC
ATCCCCGTCATCTCCAACACCACCGGACAGCCCGCCGAAAACCTCACATCCCCCGACTAC
TGGACCCAACACATCCGCCGCCCCGTCCGCTTCACCGACAGCCTCCACCACCTCACCCAG
CAGGGTGTGACGACCTTCCTCGAACTCGGTCCCGATGCCACCCTCGCCATGCTCGCCGAC
GCCCACGCCACCGCCGTCCTGCGCAGGAACTCGTCCGAGCCGCAGGCCCTGCGTACGGCG
CTCGCCGAGCTGTGGGTCCACGGCGTTCCGGTGGCTTGGCCTCACTCGACCGACCGGCGC
GTGGATCTGCCGACCTACGCCTTCGACCACCAGCACTACTGGCTGGACGCGGCGCCCGGA
ACCTCCGCCACCTCCGTCCGCCCGTCGGTGCCGGTGGAGGCCGCCGACGCACCGCCCACG
CTCGCTGATCGGTTCGAGGGACTGGGCGCGGGCGAACGGACCTCCATGGCTGAGGAGTTG
GTCCGTGAGACGGTCGCTGTCGTCCTGGGGTTCGCCGACCCGGAGGACGTGGACGTGTCC
ACGCCGTTCATCAAGCTGGGCATCGACTCACTGACGGCGGTGGAACTGCGCAGGCGGCTG
GGCGGGTACACCGGCCTGGAGATCCCCGCCGTGGTCGTGTTCGAGCATCCGACCACCCAC
GACCTCGCCGAGTACCTGATCGAGGCGATGTCCGCGCCTCCGGGAGCGACGCCGGACGGC
GCTTCGGGTGCGCCTTCCGGCGTTCGGGCGACCGCCGCGGTGGACTCGCTCTCGGATCTC
TTCGTCCGGGCGTGTGGACGGGGGGAGTTCGCCGAGGCCCACCGTCTCGCGCTGGGGCTC
GCCGAGTACCGGCCCACCTTCGCGGGCGAGCTGGACGGGGCGCGGTCGCCGGACGTCGTA
CCGCTTCGTCGAGGTACGGCGTCGCCGGCCGTGGTGTGCTTCCCGTCGTTCGTCTGGAAG
CCCGACTTCCAGCAGTACCTGTCGCTGGCCCGGGAGTTGACCGAGGACCGGGACGTCGCG
GTGTCGGGGCTGCCCGGGTTCCGGCCCGGGGAGCCGTTGCCCGCTTCGGCGGAGGCGCTG
GCGCGGGCGCTGGCGGCCGTGGTGCGCCGGGTCGCCGGTGGGCGGCGGTGTGTTCTGCTC
GGTCACTCGTCGGGGGGCTATGTGGCGGCGGCGGTGGCGGCACAGCTGGAGGAGGCGGGC
GAGGCGCCCGCCGGGCTGGTGCTGGTCGACACGCCGTGGTGGGGTTCCGCGGGCGGGCTG
GGGTCGCAGGAGTGGCTTCCGGTGATCAACGAGATGCTGCTGGCGCGCGGTGCGGCTGCG
GGTGCGGAGGACAGCGACGCGGGTGACGCCTGGGTCACCGCGCGGGCCAAGTACTTCAGC
CTGGACTTCGCGATCGCGCCACGGGATGTGCGGACCCTGCTGCTGCGGCCGGCCGAACCG
CTGGCCGGTTCCGCCGCGGACGCCGGCTGGCGCGCCGAGTGGCGGCCAGGCACCACGGTC
GTCGAGGTGCCGGGGAACCACTTCTCGATGCTGGACAGCGCCCATGCCCAGGCATGCGCC
AGGGCGGTGGAGGGCTGGCTCGCCACTCTGGGATAG
[11] KS35..411
[11] AT566..868
[11] malonyl-CoA753..757
[11] ACP937..1007
[11] TE1105..1307
[11] KS103..1233
[11] AT1696..2604
[11] malonyl-CoA2257..2271
[11] ACP2809..3021
[11] TE3313..3921

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [1105-1307]  9.8e-26 PF00975
PF00975   Thioesterase
IPR001227 Acyl transferase domain (Domain)
 [555-688]  1.10000000000001e-78 G3DSA:3.40.366.10 [753-859]  1.10000000000001e-78 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [965-980]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [930-1046]  1.60000240695997e-21 SSF47336
SSF47336   ACP_like
 [940-1006]  7.79999999999999e-15 PF00550
PF00550   PP-binding
 [937-1009]  6.70000000000001e-20 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [937-1007]  PS50075
PS50075   ACP_DOMAIN
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [35-285]  1e-99 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [293-411]  3.29999999999997e-51 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [566-868]  3.89999999999997e-64 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [563-861]  1.19999063421924e-72 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [690-752]  3.89999861795218e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [37-297]  2.99999999999998e-92 G3DSA:3.40.47.10 [298-464]  2.90000000000003e-68 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [27-409]  6.19996040581186e-107 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [198-214]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [567-851]  1.50000965748778e-118 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [938-1010]  2.30000440726534e-27 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [37-463]  SM00825
SM00825   PKS_KS
SignalP No significant hit
TMHMM No significant hit