close all open/close all

CDS information : Lasal2_00230


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction80,597 / 80,229 / - [in whole cluster]
80,597 / 80,229 / - [in contig]
Locationcomplement(80229..80597) [in whole cluster]
complement(80229..80597) [in contig]
TypeCDS
Length369 bp (122 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)las7
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MSDTREMIISAPVERVWAVLTEDKYLSQWFGEADTEMDLRPGGKMIFRFKNGGVFSATIE
RIEPHQYFSYRVLTVPTEAEPDDTNSRLIEFTLTPEGSDSTRLGLAESNSHLDGIKRVAE
SI
selected fasta
>hypothetical protein [hypothetical protein]
ATGAGTGACACGCGGGAAATGATCATCTCGGCTCCGGTGGAGCGCGTGTGGGCCGTCCTC
ACCGAGGACAAGTACCTGAGCCAGTGGTTCGGCGAGGCCGACACCGAGATGGATCTGCGT
CCCGGCGGAAAGATGATCTTCCGCTTCAAGAACGGCGGCGTGTTCTCCGCCACGATCGAG
CGGATCGAGCCCCACCAGTATTTCTCCTACCGCGTGCTGACGGTGCCGACCGAGGCGGAG
CCCGACGACACGAACTCCCGGCTCATCGAATTCACCCTGACTCCCGAAGGATCGGACAGC
ACGCGGCTGGGGCTCGCGGAAAGCAACTCCCACCTCGACGGAATCAAGCGGGTCGCCGAA
TCCATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013538 Activator of Hsp90 ATPase homologue 1-like (Family)
 [11-110]  1.2e-16 PF08327
PF08327   AHSA1
IPR023393 START-like domain (Domain)
 [5-111]  2.1e-22 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit