close all open/close all

CDS information : Lasal2_00260


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction83,421 / 84,350 / + [in whole cluster]
83,421 / 84,350 / + [in contig]
Location83421..84350 [in whole cluster]
83421..84350 [in contig]
TypeCDS
Length930 bp (309 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative S12 family peptidase
Product (GenBank)serine-type D-Ala-D-Ala carboxypeptidase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF10; beta-lactamase class C and other penicillin binding proteins
Reference
ACC
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)
Related Reference
ACC
B6ZK73
NITE
Lasal_00220
PmId
[19129623] Identification of a gene cluster of polyether antibiotic lasalocid from Streptomyces lasaliensis. (Biosci Biotechnol Biochem. , 2009)
ACC
P15555
PmId
[3830154] Primary structure of the Streptomyces R61 extracellular DD-peptidase. 1. Cloning into Streptomyces lividans and nucleotide sequence of the gene. (Eur J Biochem. , 1987)
[3030739] Primary structure of the Streptomyces R61 extracellular DD-peptidase. 2. Amino acid sequence data. (Eur J Biochem. , 1987)
[2175384] Transcriptional analysis of the DD-peptidase/penicillin-binding protein-encoding dac gene of Streptomyces R61: use of the promoter and signal sequences in a secretion vector. (Mol Gen Genet. , 1990)
[7490745] The refined crystallographic structure of a DD-peptidase penicillin-target enzyme at 1.6 A resolution. (J Mol Biol. , 1995)

close this sectionSequence

selected fasta
>putative S12 family peptidase [serine-type D-Ala-D-Ala carboxypeptidase]
MHRQVPVPHDGQVRAGSNTKSFTATVVLQLVAEGKVRLDAPIETYLPQLVRGKGIDGHRI
TVRQLLQHTSGLPNYTEYIGMENFEGLQHRFFQPHDLLSAALAHPAHFPPGSRWEYSNTN
YLVAGLLIERVTGRPVQEEITQRVIRKAGLRHTYWPQPGDQTLRGPHPHGYTTGNLEKGN
VIDATVMDPSWGGAAGQLISTPSDLAAFARALLDGRLLPPAQLAEMRKTVDAPLLPGWRY
GLGLFSVPLSCGGVYWGHGGDIDGFETRGGATDDGRSVGLAVTALPGTFGDADEAAKAVM
AAVDTAFCK
selected fasta
>putative S12 family peptidase [serine-type D-Ala-D-Ala carboxypeptidase]
TTGCACCGGCAGGTGCCGGTCCCCCACGACGGCCAGGTCAGGGCGGGCAGCAACACGAAG
AGCTTCACGGCGACCGTGGTGCTGCAGCTCGTGGCCGAGGGCAAGGTCCGGCTCGACGCG
CCCATCGAGACCTACCTGCCCCAACTGGTGCGCGGAAAGGGCATCGACGGCCACCGGATC
ACCGTACGGCAGCTCCTTCAGCACACCAGCGGACTTCCCAACTACACCGAATACATCGGC
ATGGAGAACTTCGAGGGACTGCAGCACAGGTTCTTCCAGCCGCACGACCTGCTGTCCGCC
GCCCTGGCCCATCCCGCGCACTTCCCGCCCGGCTCGCGGTGGGAGTACAGCAACACCAAT
TACCTGGTGGCGGGCCTGCTGATCGAGCGGGTCACCGGGCGGCCGGTGCAGGAGGAGATA
ACCCAGCGCGTGATCAGGAAGGCCGGGCTGCGCCACACGTACTGGCCGCAGCCCGGTGAC
CAGACCCTACGGGGACCGCACCCGCACGGATACACGACCGGCAACCTGGAGAAGGGCAAC
GTCATCGACGCCACCGTCATGGACCCGTCCTGGGGCGGGGCGGCCGGCCAGCTGATCTCG
ACCCCGAGCGATCTGGCGGCGTTCGCCCGTGCGTTGCTCGACGGACGGCTGCTGCCGCCC
GCCCAGTTGGCGGAGATGCGCAAGACGGTCGACGCGCCGCTGCTGCCGGGGTGGCGGTAC
GGACTCGGCCTGTTCAGCGTTCCGTTGAGTTGCGGCGGCGTGTACTGGGGGCACGGCGGC
GACATCGACGGCTTCGAGACCCGTGGCGGCGCCACGGACGACGGCCGCTCGGTCGGACTC
GCGGTGACCGCCCTGCCGGGGACCTTCGGTGACGCCGACGAGGCCGCGAAGGCCGTCATG
GCGGCCGTGGACACGGCGTTCTGCAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001466 Beta-lactamase-related (Domain)
 [3-300]  3.80000000000003e-57 PF00144
PF00144   Beta-lactamase
IPR012338 Beta-lactamase/transpeptidase-like (Domain)
 [3-300]  1.09999184471405e-75 SSF56601
SSF56601   PBP_transp_fold
 [4-303]  5.00000000000001e-69 G3DSA:3.40.710.10
G3DSA:3.40.710.10   G3DSA:3.40.710.10
SignalP
 [1-32]  0.116 Signal
Bacteria, Gram-negative   
 [1-38]  0.119 Signal
Eukaryota   
TMHMM No significant hit