close all open/close all

CDS information : Lasal2_00270


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction85,167 / 84,406 / - [in whole cluster]
85,167 / 84,406 / - [in contig]
Locationcomplement(84406..85167) [in whole cluster]
complement(84406..85167) [in contig]
TypeCDS
Length762 bp (253 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF11
Reference
ACC
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MTANPGTRLRRLTVALAVLPLAVACHGGDGGSGGPRADGMLGAVDSGSTVVITTDNGVRL
RPADGRSVSVDGDVGAHWSHHDDMEVLDLSCDEQDREGRPCPRMPTVEVPDDVRVTVTAR
NAGVDVVGIAAALDVTTVNGDVTVARSGRDDAAVKLTTRNGSVRVTAVAADRLYAVTSNG
DVVLACATAASRVTGRTTNGSVDVTVPDDAPAYRVTATTRNGQPRITVPTLTAGDGPAMT
LSTVNGDVAAHRE
selected fasta
>hypothetical protein [hypothetical protein]
ATGACTGCGAACCCCGGAACTCGCCTGCGCCGTCTGACCGTTGCCCTGGCTGTGCTGCCC
CTGGCCGTGGCCTGCCACGGCGGGGACGGTGGCTCCGGAGGCCCGCGGGCCGACGGGATG
CTCGGCGCCGTGGACTCCGGCAGCACGGTCGTCATCACCACCGACAACGGGGTCAGGCTG
CGCCCCGCCGACGGACGGAGCGTCTCCGTCGACGGCGATGTCGGCGCGCACTGGTCGCAC
CACGACGACATGGAGGTGCTGGACCTCTCCTGCGACGAACAGGACCGCGAGGGCCGCCCG
TGCCCACGCATGCCCACGGTGGAGGTTCCGGACGACGTACGCGTCACGGTCACCGCACGC
AACGCGGGCGTCGACGTCGTCGGCATCGCGGCCGCGCTGGACGTGACCACCGTCAACGGC
GATGTCACGGTGGCCCGTTCCGGCCGGGACGACGCGGCCGTCAAACTGACCACCCGCAAC
GGCTCGGTGCGCGTCACCGCGGTCGCCGCCGACCGCCTGTACGCCGTGACGTCCAACGGG
GACGTCGTCCTCGCCTGCGCCACGGCCGCGAGCCGCGTCACCGGGCGCACCACCAACGGC
TCGGTCGACGTCACCGTGCCGGACGACGCCCCCGCCTACCGGGTCACGGCCACCACCCGC
AACGGCCAACCGCGCATCACCGTACCGACCCTCACTGCCGGCGACGGCCCCGCGATGACA
CTGAGCACGGTCAACGGCGACGTGGCGGCCCACCGGGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR025386 Domain of unknown function DUF4098 (Domain)
 [115-184]  6.70000000000001e-12 PF13345 [191-249]  0.071 PF13345
PF13345   DUF4098
SignalP
 [1-27]  0.624 Signal
Bacteria, Gram-negative   
 [1-31]  0.463 Signal
Bacteria, Gram-positive   
 [1-24]  0.713 Signal
Eukaryota   
TMHMM No significant hit