close all open/close all

CDS information : Lasal2_00290


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction86,265 / 86,050 / - [in whole cluster]
86,265 / 86,050 / - [in contig]
Locationcomplement(86050..86265) [in whole cluster]
complement(86050..86265) [in contig]
TypeCDS
Length216 bp (71 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF13

close this sectionSequence

selected fasta
>[hypothetical protein]
MVVVLLCVFIVMGLVQVFRPQLLWRANRPLQRPFVKDYDATEPTKAGYTVARVGGVVFLV
VATWMLIRHLT
selected fasta
>[hypothetical protein]
ATGGTCGTCGTGCTGCTGTGCGTGTTCATCGTGATGGGACTCGTCCAGGTGTTCAGGCCC
CAGTTGCTGTGGAGGGCCAACCGCCCGCTCCAGCGCCCGTTCGTGAAGGACTACGACGCC
ACGGAACCCACGAAGGCGGGCTACACGGTGGCCAGGGTCGGGGGCGTGGTCTTCCTCGTC
GTGGCGACATGGATGCTCATCAGGCACCTCACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM
 [2-24]  Transmembrane (i-o) [48-70]  Transmembrane (o-i)
Transmembrane 2