close all open/close all

CDS information : Lasal2_00300


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction86,553 / 87,341 / + [in whole cluster]
86,553 / 87,341 / + [in contig]
Location86553..87341 [in whole cluster]
86553..87341 [in contig]
TypeCDS
Length789 bp (262 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF14

close this sectionSequence

selected fasta
>[hypothetical protein]
MGGYAAVRKAARAGIEECGPDPVLLRWLGQAHAAEDEDDHDRAAEAAYRQGLALAADDLG
LLVSYWELCLRSDSFDHPHRAKRAVTLQQRIEELAPPGSPERGRVDAAVGWAGRGYWDDV
VASAARGQAEQEVLAEQSVLVTDALRRAARGEVREDTGEDLHAAELAAAVELLQGPRNAP
LRLLLAHRVGAYVLTFLASFTLNKALVWSGVLRFSMWGWLLWIPLLVAEAKLRQARRLGQ
QRVIARMQARHEEARDRAPSAG
selected fasta
>[hypothetical protein]
GTGGGCGGCTACGCCGCGGTGCGGAAGGCGGCCCGGGCGGGGATCGAGGAGTGCGGGCCG
GACCCGGTCCTCCTGCGCTGGCTAGGTCAGGCGCACGCCGCGGAGGACGAGGACGACCAC
GACCGCGCAGCCGAAGCCGCCTACCGTCAGGGCCTCGCCCTCGCAGCGGACGATCTCGGG
CTCCTGGTGTCGTACTGGGAGCTCTGCCTGCGCTCGGACTCCTTCGACCACCCGCACCGG
GCGAAGCGGGCCGTGACCTTGCAGCAGAGGATCGAGGAGTTGGCTCCACCGGGGTCGCCC
GAGCGCGGGCGCGTCGATGCCGCGGTCGGCTGGGCCGGGCGGGGCTACTGGGACGACGTG
GTGGCGAGCGCGGCCCGGGGACAGGCCGAGCAGGAGGTCCTCGCCGAGCAGAGCGTGCTG
GTCACCGACGCGCTGCGGCGAGCCGCTCGCGGCGAGGTCCGCGAGGACACCGGGGAGGAC
CTGCACGCCGCCGAACTCGCCGCGGCGGTCGAGCTGTTGCAGGGGCCCCGCAACGCTCCC
CTGCGCCTGCTCCTCGCACATCGCGTCGGTGCGTACGTCCTGACGTTCCTCGCGTCGTTC
ACCTTGAACAAGGCGCTGGTGTGGAGCGGGGTGCTGCGCTTCAGCATGTGGGGCTGGCTG
TTGTGGATCCCGCTGCTCGTGGCCGAGGCCAAGCTCCGCCAGGCCAGGAGGCTGGGGCAG
CAGCGCGTCATCGCACGCATGCAGGCACGTCACGAGGAGGCACGGGACCGCGCCCCTTCC
GCGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM
 [205-227]  Transmembrane (o-i)
Transmembrane 1