close all open/close all

CDS information : Lasal2_00310


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction88,023 / 87,418 / - [in whole cluster]
88,023 / 87,418 / - [in contig]
Locationcomplement(87418..88023) [in whole cluster]
complement(87418..88023) [in contig]
TypeCDS
Length606 bp (201 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)TetR family transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF15

close this sectionSequence

selected fasta
>[TetR family transcriptional regulator]
MAVRGRPRGFDADAALDRAVEVFWRQGYEGASLTDLTDAMGINRTSMYAAFGNKEELFHR
AVARYAEADMAYARAALAQPTAHAVVETFLRANADALTRADRPSGCLSVQGGLAEGGEGG
RVAAFLADSRLAGERALAQRLASAVEEGDLPADTDPDALARYVMVVSEGNAVHAAGGANR
EALHATVDIALRALPRADAEA
selected fasta
>[TetR family transcriptional regulator]
ATGGCGGTACGCGGCAGACCCCGTGGCTTCGACGCCGACGCCGCGCTCGACCGGGCGGTG
GAGGTCTTCTGGCGCCAGGGCTACGAGGGCGCGTCGCTGACCGACCTCACCGACGCCATG
GGCATCAACCGGACCAGCATGTACGCGGCGTTCGGCAACAAGGAGGAACTCTTCCACCGT
GCCGTCGCCCGCTACGCCGAGGCGGACATGGCGTACGCCCGCGCAGCCCTCGCGCAGCCC
ACCGCCCACGCGGTCGTCGAGACCTTCCTGCGCGCCAACGCCGACGCGCTCACCCGGGCC
GACCGCCCCTCGGGATGCCTGTCCGTGCAGGGCGGCCTGGCCGAGGGCGGCGAAGGCGGC
CGCGTCGCCGCGTTCCTCGCGGACAGCCGCCTGGCGGGCGAACGGGCCCTCGCCCAGCGC
CTGGCCAGCGCCGTCGAGGAGGGCGACCTGCCCGCGGACACCGACCCGGACGCGCTCGCC
CGCTACGTCATGGTCGTCAGCGAGGGCAACGCCGTCCACGCGGCGGGCGGCGCGAACCGG
GAGGCACTGCACGCGACGGTCGACATCGCGCTGCGGGCCCTGCCCCGGGCCGACGCGGAG
GCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [15-28]  8.80000265836278e-05 PR00455 [36-59]  8.80000265836278e-05 PR00455
PR00455   HTHTETR
 [16-60]  1.6e-11 PF00440
PF00440   TetR_N
 [9-69]  PS50977
PS50977   HTH_TETR_2
IPR009057 Homeodomain-like (Domain)
 [7-80]  4.00000300869883e-16 SSF46689
SSF46689   Homeodomain_like
 [3-67]  1.69999999999999e-20 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [80-195]  1.20000117458134e-26 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [70-196]  1.09999999999999e-36 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
IPR023772 DNA-binding HTH domain, TetR-type, conserved site (Conserved_site)
 [27-57]  PS01081
PS01081   HTH_TETR_1
SignalP No significant hit
TMHMM No significant hit