close all open/close all

CDS information : Lasal2_00320


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction88,177 / 88,923 / + [in whole cluster]
88,177 / 88,923 / + [in contig]
Location88177..88923 [in whole cluster]
88177..88923 [in contig]
TypeCDS
Length747 bp (248 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)probable glucose dehydrogenase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF16

close this sectionSequence

selected fasta
>[probable glucose dehydrogenase]
MGQLDGRTALVTGATSGIGLAAARRLAAEGAHVFLTGRRQEALDEAVVSIGARATGVRAD
VANLDDLDRLFAAVRQHGRLDIVFANAGGGEFAALPDITWDHYADTFHTNVGGTLFTVQK
ALPLLTEGSSIILTSSNIDTRGAASFSVYAATKAALRSLTRSWAAELVTRGIRVNAIAPG
PVETPGLSGLADGPEAAEQLLQGLAAGVPMKRLGRPEEIADTVLFLASDASSYMTGAEIY
VDGGASQI
selected fasta
>[probable glucose dehydrogenase]
ATGGGACAGCTCGACGGCAGGACCGCCCTCGTCACCGGCGCCACCTCCGGCATCGGCCTG
GCAGCCGCCCGCCGGCTCGCCGCGGAGGGCGCCCACGTCTTCCTCACCGGCCGTCGGCAG
GAGGCGCTGGACGAAGCGGTCGTCTCGATCGGCGCACGCGCGACCGGCGTGCGCGCCGAC
GTCGCGAACCTCGACGACCTGGACCGTCTCTTCGCCGCCGTCCGGCAGCACGGTCGTCTC
GACATCGTGTTCGCCAACGCCGGCGGCGGGGAGTTCGCGGCCCTGCCCGACATCACCTGG
GACCACTACGCCGACACGTTCCACACCAATGTCGGCGGCACCCTGTTCACCGTCCAGAAG
GCGCTCCCCCTGCTCACGGAGGGCTCCTCGATCATCCTGACCAGCTCCAACATCGACACC
AGGGGCGCCGCGTCGTTCAGCGTCTACGCCGCCACCAAGGCCGCCCTGCGGTCCCTGACC
CGGAGCTGGGCCGCGGAACTCGTCACCCGCGGCATCCGCGTCAACGCCATCGCCCCCGGG
CCGGTCGAGACGCCGGGCCTCAGCGGCCTGGCCGACGGACCCGAGGCGGCCGAGCAGCTG
CTGCAGGGGCTGGCCGCCGGGGTCCCCATGAAGCGGCTCGGCCGCCCCGAGGAGATCGCC
GACACCGTGCTGTTCCTCGCGAGCGACGCCAGCAGCTACATGACCGGCGCGGAGATCTAC
GTCGACGGCGGTGCCAGCCAGATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [8-25]  1.90000694315261e-37 PR00081 [78-89]  1.90000694315261e-37 PR00081 [149-168]  1.90000694315261e-37 PR00081 [170-187]  1.90000694315261e-37 PR00081 [209-229]  1.90000694315261e-37 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [2-246]  2.59999999999995e-83 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [136-164]  PS00061
PS00061   ADH_SHORT
SignalP No significant hit
TMHMM No significant hit