close all open/close all

CDS information : Lasal2_00330


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction89,074 / 89,643 / + [in whole cluster]
89,074 / 89,643 / + [in contig]
Location89074..89643 [in whole cluster]
89074..89643 [in contig]
TypeCDS
Length570 bp (189 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF17

close this sectionSequence

selected fasta
>[hypothetical protein]
MSERNTAIRSLHDLGLAAWFGGSLMGAVGLNGAAKDEGGTETTTDRISSAGWAKWTPVNA
AAIGAHLFGGGGLLAVNAQRVATQQGVAASTVAKTVVTAAALAATAYARVLGKKVELASS
TDPDDLEKARQHPVDLHKARRQLACAQWAVPALTGCLVVLNALHGEQQRPSQQVPGMWER
AMSATHFGG
selected fasta
>[hypothetical protein]
ATGTCCGAACGCAACACCGCCATCCGCAGCCTGCACGACCTGGGCCTGGCGGCCTGGTTC
GGCGGATCGCTGATGGGCGCGGTCGGCCTCAACGGCGCGGCCAAGGACGAGGGCGGCACG
GAGACCACCACCGACCGCATCTCGTCGGCCGGCTGGGCCAAGTGGACGCCGGTCAACGCC
GCCGCGATCGGCGCGCACCTGTTCGGCGGCGGCGGGCTGCTCGCGGTGAACGCGCAGCGC
GTCGCCACCCAGCAGGGCGTGGCCGCCTCCACCGTGGCCAAGACCGTCGTCACCGCCGCG
GCCCTGGCCGCCACCGCCTACGCCCGCGTCCTCGGCAAGAAGGTGGAGCTGGCCTCCTCG
ACCGACCCCGACGACCTCGAGAAGGCGCGGCAGCACCCCGTGGACCTGCACAAGGCGCGG
CGGCAGCTGGCCTGCGCGCAGTGGGCGGTGCCGGCGCTGACCGGGTGCCTGGTGGTCCTC
AACGCCCTGCACGGCGAGCAGCAGCGTCCCAGCCAGCAGGTCCCCGGCATGTGGGAGCGG
GCCATGTCCGCGACCCACTTCGGGGGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit