close all open/close all

CDS information : Lasal2_00340


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction89,789 / 90,247 / + [in whole cluster]
89,789 / 90,247 / + [in contig]
Location89789..90247 [in whole cluster]
89789..90247 [in contig]
TypeCDS
Length459 bp (152 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF18

close this sectionSequence

selected fasta
>[hypothetical protein]
MSAQARAPHTARTPVQQAALIVGAVFLLVGVLGFIPGVTTHYGTMEFAAHHSEAELLGIF
QVSVLHNLVHLAFGIAGLALSRTAAQARSYLLVGGAVYLVLWLYGLLIDRDSGANFVPVN
TADNWLHFLLGLGMIALGALLTRGRSTTHAAA
selected fasta
>[hypothetical protein]
ATGTCCGCGCAAGCACGTGCTCCGCACACCGCCCGCACGCCCGTCCAGCAGGCCGCCCTG
ATCGTGGGGGCCGTCTTCCTGCTGGTGGGCGTGCTCGGGTTCATCCCGGGCGTCACCACG
CACTACGGCACGATGGAGTTCGCCGCCCACCACTCCGAGGCCGAACTCCTGGGCATCTTC
CAGGTGTCCGTCCTGCACAACCTCGTGCACCTCGCCTTCGGCATCGCCGGACTGGCCCTG
TCGCGCACGGCGGCCCAGGCGCGGAGCTACCTGCTCGTCGGGGGCGCGGTCTACCTGGTG
CTGTGGCTGTACGGCCTGCTCATCGACCGGGACAGCGGGGCGAACTTCGTGCCGGTCAAC
ACGGCCGACAACTGGCTCCACTTCCTGCTCGGCCTGGGGATGATCGCCCTGGGCGCGCTG
CTCACCCGCGGACGCAGCACGACGCACGCGGCCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR025492 Protein of unknown function DUF4383 (Family)
 [15-140]  1.40000000000001e-46 PF14325
PF14325   DUF4383
SignalP No significant hit
TMHMM
 [21-43]  Transmembrane (i-o) [58-80]  Transmembrane (o-i) [87-109]  Transmembrane (i-o) [124-141]  Transmembrane (o-i)
Transmembrane 4