close all open/close all

CDS information : Lasal2_00350


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction91,271 / 90,282 / - [in whole cluster]
91,271 / 90,282 / - [in contig]
Locationcomplement(90282..91271) [in whole cluster]
complement(90282..91271) [in contig]
TypeCDS
Length990 bp (329 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)peptidase U61 LD-carboxypeptidase A
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF19; homologs of microcin C7 resistance protein MccF

close this sectionSequence

selected fasta
>[peptidase U61 LD-carboxypeptidase A]
MPAVLRPRALRSGDLVVVTALSGQLEPGEEPLLARGVAILERMGFRVRVSPLVDPARPRW
WAAGTPAEQAAELNALLRDPEVRAVVAHTGGQATIGYLDLIDLDAIRADPKPIIGYSDIS
LLHMALHAQTGLVGFHADIATHGFGSDWYTLVDEARRSELVDLYTRVLTRAEAPGALPAN
GPWETWRPGRAQGRLFGGLLNRLVLLQATPFAPPAELFDGAVLFWEELQRPVSRIWNDLH
TLRLSGVLDRIAGMVVGIPTEVTPHDGGGRHVDLRDVVLDVLGQRDIPVLAQVDFGHTSP
NLPLPIGVRADVDADGRTLTLLEPAVARG
selected fasta
>[peptidase U61 LD-carboxypeptidase A]
ATGCCTGCGGTTCTTCGGCCCCGTGCCCTGCGTTCCGGCGATCTGGTGGTCGTGACCGCG
CTCTCGGGTCAGCTCGAGCCGGGGGAGGAGCCGCTGCTCGCCCGTGGCGTGGCGATCCTC
GAACGGATGGGGTTCCGGGTGCGGGTCAGTCCGCTGGTCGACCCGGCGCGGCCCCGCTGG
TGGGCGGCGGGAACGCCCGCGGAGCAGGCCGCCGAGCTCAACGCCCTGCTGCGGGACCCG
GAGGTACGGGCCGTCGTTGCGCACACCGGCGGGCAGGCGACCATCGGTTACCTCGACCTG
ATCGACCTGGACGCGATCCGCGCCGACCCGAAACCGATCATCGGCTACAGCGACATCTCG
CTGCTGCACATGGCCCTGCACGCGCAGACCGGCCTCGTCGGCTTCCACGCGGACATCGCC
ACCCACGGCTTCGGCAGCGACTGGTACACACTGGTCGACGAGGCCCGCCGCTCCGAGCTC
GTCGACCTCTACACCCGTGTCCTCACCAGGGCCGAGGCCCCGGGCGCGCTGCCGGCGAAC
GGCCCCTGGGAGACCTGGCGGCCGGGCCGCGCGCAGGGTCGCCTGTTCGGCGGCCTGCTG
AACCGCCTGGTCCTGCTCCAGGCGACGCCGTTCGCGCCGCCCGCCGAACTCTTCGACGGC
GCCGTCCTGTTCTGGGAGGAGCTGCAGCGGCCGGTCTCCCGGATCTGGAACGACCTGCAC
ACCCTGCGGCTGTCCGGGGTGCTGGACCGGATCGCGGGGATGGTCGTCGGCATCCCCACC
GAGGTCACGCCCCACGACGGCGGCGGCCGGCACGTGGACCTGCGGGACGTGGTGCTCGAC
GTCCTGGGGCAGCGTGACATCCCGGTCCTCGCCCAGGTCGATTTCGGCCACACCTCACCG
AACCTGCCGCTGCCCATCGGCGTCCGCGCGGACGTGGACGCCGATGGGCGGACGCTGACC
CTGCTCGAGCCGGCGGTGGCACGGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003507 Peptidase S66, LD-carboxypeptidase A (Family)
 [17-313]  9.60000000000003e-63 PF02016
PF02016   Peptidase_S66
 [1-327]  1.90000694315261e-54 PIRSF028757
PIRSF028757   LD-carboxypeptidase
SignalP No significant hit
TMHMM No significant hit