close all open/close all

CDS information : Lasal2_00360


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction91,714 / 91,944 / + [in whole cluster]
91,714 / 91,944 / + [in contig]
Location91714..91944 [in whole cluster]
91714..91944 [in contig]
TypeCDS
Length231 bp (76 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF20

close this sectionSequence

selected fasta
>[hypothetical protein]
MVRRLMSSIWGKGRWCPPGCTAKRRMPRCSPGPRGAAVSTRSQTVAITGSAAADLGDDVG
ASARTHPWMAREQAGP
selected fasta
>[hypothetical protein]
ATGGTGCGCCGGCTGATGAGCTCCATCTGGGGCAAGGGCCGCTGGTGCCCGCCGGGCTGC
ACCGCGAAGCGGCGGATGCCCAGGTGCTCGCCCGGACCGAGGGGCGCGGCCGTCTCCACG
AGGTCCCAGACCGTCGCGATCACCGGGTCCGCGGCGGCGGACCTGGGCGATGACGTGGGC
GCGTCGGCGCGCACCCACCCGTGGATGGCCCGTGAGCAGGCGGGGCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit