close all open/close all

CDS information : Lasal2_00380


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction93,482 / 92,919 / - [in whole cluster]
93,482 / 92,919 / - [in contig]
Locationcomplement(92919..93482) [in whole cluster]
complement(92919..93482) [in contig]
TypeCDS
Length564 bp (187 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)TetR family transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF22

close this sectionSequence

selected fasta
>[TetR family transcriptional regulator]
MPRVGLDSAAVVAAGADLADEVGLARLTMGLLAERLGVRTPSLYKHVSGQEDLLRRIAAL
AAVQAADAVGTAVQGLAGRDALAAALHAFRTFVINHPGRYAATTGLEPTGPDDPMTHATQ
RLFDVFRAVLRGYGLAESDMDHALRMFRSLCHGFATLEAASAFRWSTDIDKSFEWLIAFT
DRGLRTM
selected fasta
>[TetR family transcriptional regulator]
ATGCCTAGGGTCGGCCTGGATTCCGCCGCCGTAGTCGCGGCCGGAGCCGACCTCGCCGAT
GAGGTGGGCCTGGCCCGGCTGACCATGGGACTGCTGGCCGAGCGCCTGGGCGTGCGCACC
CCGTCCTTGTACAAGCACGTCAGCGGCCAGGAGGACCTCTTGCGGCGTATCGCGGCGCTG
GCTGCGGTCCAGGCCGCCGACGCTGTCGGCACCGCCGTCCAGGGCCTGGCGGGCCGCGAC
GCCCTGGCCGCCGCACTGCACGCCTTCCGCACCTTCGTGATCAACCACCCAGGCCGCTAC
GCTGCCACGACCGGCTTGGAACCCACCGGCCCGGACGACCCGATGACCCATGCCACCCAG
CGGCTGTTCGATGTGTTCCGGGCCGTCCTGCGCGGCTACGGGCTCGCAGAGTCCGACATG
GACCACGCCTTGCGCATGTTCCGCAGCTTGTGCCACGGCTTCGCCACACTGGAAGCGGCG
AGCGCCTTTCGCTGGAGCACCGACATCGACAAGAGCTTCGAGTGGCTGATCGCCTTCACC
GACCGGGGCCTGCGGACCATGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [12-56]  8.69999999999999e-08 PF00440
PF00440   TetR_N
 [5-65]  PS50977
PS50977   HTH_TETR_2
IPR009057 Homeodomain-like (Domain)
 [4-75]  3.7999986264479e-10 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [76-185]  3.39999972437717e-23 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [10-185]  1.9e-23 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
IPR025996 WHG domain (Domain)
 [84-159]  2.7e-08 PF13305
PF13305   WHG
SignalP No significant hit
TMHMM No significant hit