close all open/close all

CDS information : Lasal2_00390


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction94,311 / 93,475 / - [in whole cluster]
94,311 / 93,475 / - [in contig]
Locationcomplement(93475..94311) [in whole cluster]
complement(93475..94311) [in contig]
TypeCDS
Length837 bp (278 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hydrolase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF23; predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)

close this sectionSequence

selected fasta
>[hydrolase]
MTEYLAVDAGTIAYEVEGAGPLVVLAHGMGDHRAAYRALIPRLIAAGYRVAAVDLRGCGE
SSTDWADWSRTAIAGDLLAVIRRLGGPAVLVGHSISGGAATIAAAQEPELITALVELGPF
TRKQSMGLGDLRSKRLRQGLLRLMKATVLGSVPAWRSYLEVAYPGVKPTDFAERLDRVEA
MLREPGRMKALQGMGRSTPVDAGAQLGHVRCPVLVVMGTDDPDWADPRAEGSAIVEALPM
GLGRLEMIEGAGHYPHDQYPDQVLSLMLSFLRTDAAHA
selected fasta
>[hydrolase]
ATGACCGAGTACCTTGCCGTCGACGCCGGCACGATCGCCTACGAGGTGGAGGGGGCCGGC
CCGCTGGTCGTTCTCGCGCATGGCATGGGTGACCACCGCGCCGCCTACCGCGCCCTGATC
CCGCGGCTGATCGCGGCGGGCTACCGGGTCGCCGCTGTCGACCTGCGCGGCTGCGGTGAG
TCAAGCACCGACTGGGCGGACTGGAGCCGCACCGCCATCGCCGGCGACCTGCTCGCGGTG
ATCCGTCGCCTGGGCGGTCCGGCGGTGCTCGTGGGCCACTCGATCTCCGGCGGAGCCGCC
ACCATTGCCGCGGCACAGGAGCCGGAGCTGATCACCGCGCTGGTTGAGCTGGGACCCTTC
ACCCGCAAGCAGTCGATGGGCTTGGGCGACCTGCGCAGCAAGCGCCTGCGACAGGGTCTT
CTGCGGCTGATGAAGGCGACCGTGCTCGGCAGTGTGCCGGCGTGGCGCTCCTACCTGGAG
GTGGCCTACCCCGGGGTGAAGCCGACCGATTTCGCCGAGCGGCTCGACCGCGTCGAGGCG
ATGCTGCGCGAGCCGGGCCGGATGAAGGCCCTTCAGGGCATGGGCCGCAGCACCCCCGTC
GACGCCGGCGCACAGCTCGGCCATGTGCGCTGCCCGGTCCTCGTCGTGATGGGCACCGAC
GACCCCGACTGGGCCGACCCGCGCGCCGAGGGTTCGGCGATCGTCGAAGCCCTCCCCATG
GGCCTCGGCCGCCTCGAGATGATCGAGGGCGCCGGGCACTACCCGCACGACCAGTACCCT
GACCAGGTGCTTTCCCTGATGCTCTCCTTCCTTCGAACGGACGCTGCCCATGCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000639 Epoxide hydrolase-like (Family)
 [27-45]  4.70000326671386e-09 PR00412 [47-62]  4.70000326671386e-09 PR00412 [104-117]  4.70000326671386e-09 PR00412 [248-270]  4.70000326671386e-09 PR00412
PR00412   EPOXHYDRLASE
SignalP No significant hit
TMHMM No significant hit