close all open/close all

CDS information : Lasal2_00410


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction95,386 / 95,733 / + [in whole cluster]
95,386 / 95,733 / + [in contig]
Location95386..95733 [in whole cluster]
95386..95733 [in contig]
TypeCDS
Length348 bp (115 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF25

close this sectionSequence

selected fasta
>[hypothetical protein]
MAAACATALAAAAITVGAPAQAAQATTTTHCATSTSIALLPSGSGFLFPNLFVSQSACGF
VDNGPLYYFTVDKATSNASVLSGPPRPYVVYNLSVVCSAVTVNGDTVWATGCGPT
selected fasta
>[hypothetical protein]
GTGGCCGCGGCGTGCGCGACAGCTCTGGCCGCGGCCGCCATAACCGTCGGCGCCCCGGCG
CAAGCCGCTCAGGCAACGACCACTACCCATTGCGCGACGTCCACGTCCATCGCCCTGCTG
CCGTCCGGCAGCGGCTTCCTCTTCCCCAACCTCTTCGTCTCGCAGTCCGCGTGTGGTTTC
GTCGACAACGGCCCCCTGTACTACTTCACGGTCGACAAGGCGACGAGCAATGCGTCGGTG
CTCTCGGGTCCGCCGCGCCCCTATGTCGTCTACAACCTGTCCGTGGTGTGCTCCGCCGTG
ACCGTCAACGGCGACACCGTCTGGGCGACCGGGTGCGGGCCGACGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-22]  0.821 Signal
Bacteria, Gram-negative   
 [1-22]  0.822 Signal
Bacteria, Gram-positive   
 [1-25]  0.556 Signal
Eukaryota   
TMHMM No significant hit