close all open/close all

CDS information : Lasal2_00420


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction96,328 / 96,014 / - [in whole cluster]
96,328 / 96,014 / - [in contig]
Locationcomplement(96014..96328) [in whole cluster]
complement(96014..96328) [in contig]
TypeCDS
Length315 bp (104 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF26

close this sectionSequence

selected fasta
>[hypothetical protein]
MEAWLRETFLPRLAGHALVILAGRVAPDAEWTLDPGWAHLCTALAVRPLDADRRSPVLLA
ARGVPAEQRGADAAFAGGRPLASRWPPPCPRRHPAHRGNRPVTS
selected fasta
>[hypothetical protein]
TTGGAGGCGTGGCTGCGCGAGACCTTCCTGCCGCGGCTCGCCGGCCACGCGCTCGTCATC
CTGGCCGGCCGGGTCGCCCCCGACGCCGAATGGACGCTGGACCCCGGCTGGGCGCACCTG
TGCACCGCGCTGGCCGTACGGCCGCTCGACGCCGACCGGCGGTCCCCCGTGCTGCTCGCC
GCCCGCGGCGTCCCCGCCGAGCAGCGCGGCGCCGACGCCGCCTTCGCCGGCGGCAGGCCG
CTGGCCTCTCGCTGGCCGCCTCCGTGCCCGCGGCGGCACCCGGCGCACCGTGGGAACCGA
CCGGTCACGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-29]  0.471 Signal
Eukaryota   
TMHMM No significant hit