close all open/close all

CDS information : Lasal2_00430


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction97,188 / 96,688 / - [in whole cluster]
97,188 / 96,688 / - [in contig]
Locationcomplement(96688..97188) [in whole cluster]
complement(96688..97188) [in contig]
TypeCDS
Length501 bp (166 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)cupin domain protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF27

close this sectionSequence

selected fasta
>[cupin domain protein]
MLPDDDLSRSLTVADPDDPGTTYVSLVGNTYAMLVTGEQTNGRYCLIDMRVPDGGGPPPH
RHDFEEMFTLLEGEIEFTFRGEKHTVRAGSTINVPANAPHHFRNVSGAPARMLCMCTPAG
QDEYFLRIGDVVEGKDAPPPQLSDDELAERRRRAAELASAYRSEFL
selected fasta
>[cupin domain protein]
ATGCTTCCCGACGACGACCTGTCCCGATCGCTGACCGTGGCCGACCCGGACGACCCCGGC
ACGACGTACGTCTCCCTCGTGGGCAACACGTACGCCATGCTGGTCACCGGCGAGCAGACC
AACGGCCGGTACTGCCTGATCGACATGCGCGTGCCTGACGGCGGCGGCCCGCCGCCGCAC
CGGCACGACTTCGAGGAGATGTTCACCCTCCTCGAGGGCGAGATCGAGTTCACCTTCCGC
GGGGAGAAGCACACCGTGCGCGCCGGGTCCACGATCAACGTCCCGGCCAACGCGCCGCAC
CACTTCCGCAACGTGTCCGGGGCGCCGGCCCGCATGCTGTGCATGTGCACCCCCGCCGGA
CAGGACGAGTACTTCCTGCGCATCGGCGACGTCGTCGAGGGCAAGGACGCGCCGCCGCCG
CAGCTGTCGGACGACGAGCTCGCCGAACGCCGCCGCCGCGCGGCCGAGTTGGCCTCGGCC
TACCGAAGCGAGTTCCTGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011051 RmlC-like cupin domain (Domain)
 [1-140]  7.69998480533694e-27 SSF51182
SSF51182   RmlC_like_cupin
IPR013096 Cupin 2, conserved barrel (Domain)
 [49-115]  1.1e-19 PF07883
PF07883   Cupin_2
IPR014710 RmlC-like jelly roll fold (Domain)
 [25-160]  2.4e-37 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP No significant hit
TMHMM No significant hit