close all open/close all

CDS information : Lasal2_00440


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction98,020 / 97,517 / - [in whole cluster]
98,020 / 97,517 / - [in contig]
Locationcomplement(97517..98020) [in whole cluster]
complement(97517..98020) [in contig]
TypeCDS
Length504 bp (167 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)MarR family transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF28

close this sectionSequence

selected fasta
>[MarR family transcriptional regulator]
MSDATPSLDPVQLGAYFDLIEVTSLLRHAVEQQLRESGDLSYVQFQLLARLGDSPTGSHR
MTDLADGVVYSRSGLTYQVGLLEKEGLVARAPAPDDERSVTVTLTGAGRELLAKVLPGHV
EVVSGLLFAPLSHDEVRSLAGLLAPVRDHMRATPPRSAASRRRKSGA
selected fasta
>[MarR family transcriptional regulator]
ATGTCTGATGCGACGCCGTCCCTCGACCCCGTGCAGCTCGGTGCCTACTTCGACCTCATC
GAGGTGACCAGCCTGCTCCGCCACGCCGTCGAGCAGCAGCTGCGCGAGAGCGGCGACCTC
AGCTACGTGCAGTTCCAGCTGCTGGCCCGCCTCGGAGACTCGCCGACGGGCAGCCACCGC
ATGACCGACCTGGCCGACGGGGTGGTCTACAGCCGTAGCGGACTGACGTACCAGGTGGGT
CTGCTCGAGAAGGAGGGCCTGGTCGCCCGCGCTCCCGCGCCGGACGACGAGCGGAGCGTC
ACCGTCACCCTCACCGGTGCCGGGCGTGAACTGCTCGCGAAGGTGCTGCCCGGGCACGTC
GAGGTGGTCAGCGGCCTCCTGTTCGCACCGCTCTCGCACGACGAGGTCAGGTCCCTCGCA
GGCCTGCTGGCGCCGGTGCGCGACCACATGCGTGCTACGCCGCCCCGCTCGGCCGCGTCA
CGACGCCGCAAGAGTGGGGCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000835 Transcription regulator HTH, MarR-type (Family)
 [76-91]  1.10000029896148e-05 PR00598 [95-111]  1.10000029896148e-05 PR00598 [126-146]  1.10000029896148e-05 PR00598
PR00598   HTHMARR
 [1-148]  PS50995
PS50995   HTH_MARR_2
 [33-136]  3.89999861795218e-15 SM00347
SM00347   HTH_MARR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [4-152]  8.00000000000001e-30 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit