close all open/close all

CDS information : Lasal2_00450


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction98,348 / 99,292 / + [in whole cluster]
98,348 / 99,292 / + [in contig]
Location98348..99292 [in whole cluster]
98348..99292 [in contig]
TypeCDS
Length945 bp (314 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)alcohol dehydrogenase zinc-binding domain protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF29; NADPH:quinone reductase and related Zn-dependent oxidoreductases

close this sectionSequence

selected fasta
>[alcohol dehydrogenase zinc-binding domain protein]
MKAVRFHEYGDPDVLVHEDVEQPVPGPGQVRVRVAATSFNPVDGNIRAGFMQGPIPVVLP
HTPGIDLAGTVDALGEGVEGLAVGDDVVGFLPMDGPGAAAEYALAPAEALTPAPKSLRLA
DAAALPLVGLTAHQALFEHGGLAAGQRVLVNGAGGAVGGYAVQMAKNAGAHVIATASARS
GDAVRSAGADEVVDHTTTGLTAAVTEPVDLALNLAPVDPAELAALLTLVKPGGVLVNTTV
WMPAPSDEERDVRGIDLFVRSDAGRLAELVASVDRGELRVDVAERVPLAELPALHARAAE
GAVHGKVVVVPSAA
selected fasta
>[alcohol dehydrogenase zinc-binding domain protein]
ATGAAGGCAGTGCGTTTCCACGAGTACGGCGACCCCGATGTCCTGGTCCACGAGGACGTG
GAGCAGCCCGTCCCCGGCCCCGGACAGGTCCGCGTCCGCGTTGCGGCGACCTCGTTCAAC
CCCGTCGACGGCAACATCCGCGCCGGCTTCATGCAGGGCCCCATCCCGGTGGTGCTGCCC
CACACCCCCGGCATCGACCTCGCCGGCACGGTCGACGCGCTCGGTGAGGGCGTCGAGGGC
CTCGCGGTCGGCGACGACGTCGTCGGCTTCCTGCCGATGGACGGCCCCGGCGCCGCCGCC
GAGTACGCCCTCGCACCGGCCGAGGCGCTGACCCCGGCGCCCAAGAGCCTCCGCCTGGCC
GACGCCGCCGCCCTGCCCCTGGTGGGCCTGACCGCGCACCAGGCCCTATTCGAGCACGGC
GGGCTGGCGGCCGGGCAGCGGGTGCTGGTCAACGGCGCCGGCGGCGCGGTGGGCGGCTAC
GCGGTGCAGATGGCCAAGAACGCCGGCGCCCACGTGATCGCCACGGCCAGTGCGCGCAGC
GGCGACGCGGTCCGCTCCGCCGGCGCCGACGAGGTCGTCGACCACACCACCACGGGCCTG
ACCGCGGCGGTGACCGAACCGGTGGACCTCGCGCTCAACCTCGCCCCCGTCGACCCGGCC
GAACTGGCCGCGCTGCTCACCCTGGTCAAGCCCGGCGGGGTCCTCGTGAACACCACGGTG
TGGATGCCCGCCCCCAGTGACGAGGAACGCGACGTGCGCGGCATCGACCTGTTCGTCCGC
AGCGACGCCGGCCGGCTCGCCGAGCTCGTGGCATCGGTCGACCGCGGCGAGCTGCGCGTC
GACGTCGCCGAGCGGGTGCCGCTCGCCGAGCTGCCCGCGCTGCACGCACGGGCCGCCGAG
GGCGCCGTGCACGGCAAGGTCGTCGTCGTCCCGTCCGCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011032 GroES-like (Domain)
 [1-163]  3.1999989904635e-42 SSF50129
SSF50129   GroES_like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [27-89]  1.7e-08 PF08240
PF08240   ADH_N
SignalP No significant hit
TMHMM No significant hit