close all open/close all

CDS information : Lasal2_00460


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction100,478 / 99,585 / - [in whole cluster]
100,478 / 99,585 / - [in contig]
Locationcomplement(99585..100478) [in whole cluster]
complement(99585..100478) [in contig]
TypeCDS
Length894 bp (297 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)AraC family transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF30

close this sectionSequence

selected fasta
>[AraC family transcriptional regulator]
MLDRLNVAMEHIERHLDRHVDVSELARITLTSEYHFRRLFSALAGMPLSEYVRRRRLTVA
AADVLDGEETLLEVALRHGYGSAEAFARAFRAVHGVGPGEARRTGAPLTAQPRLSFRLTV
EGNSSMRYRIVTKEAFRVVGKKARVPLVYEGVNPHIAEFLRGIPPETTRRIAGLSDQEPE
GVVSATVRLSDDFEEGSALEHYHAVVTGADDVPADLDVLDCPAGTWAVFENTGPFPQALQ
QMWADVAAHWIPSNPYEYRPGPEILRVRLCRDDPARSDAHLWIPVTRTATPSEVGST
selected fasta
>[AraC family transcriptional regulator]
GTGCTGGACCGGCTGAACGTGGCCATGGAGCACATCGAGCGTCACCTCGACCGGCACGTC
GACGTGTCCGAGCTGGCGCGGATCACGCTCACGTCGGAGTACCACTTCCGGCGGCTCTTC
TCGGCACTGGCCGGGATGCCGCTCTCGGAGTACGTCCGGCGTCGGCGGCTCACCGTGGCG
GCGGCGGACGTACTGGACGGCGAGGAGACCCTGCTGGAGGTCGCGCTCCGCCACGGCTAC
GGCTCGGCGGAGGCGTTCGCCCGGGCGTTCCGCGCCGTGCACGGGGTCGGCCCCGGCGAG
GCGCGGCGGACCGGTGCCCCGCTCACCGCGCAACCCCGGCTGTCCTTCCGCCTCACTGTC
GAAGGGAACAGCTCCATGCGCTACCGCATCGTGACGAAGGAAGCCTTCCGGGTCGTAGGG
AAGAAGGCCCGCGTCCCGCTGGTGTACGAGGGGGTCAACCCGCACATCGCCGAGTTCCTG
CGCGGCATCCCGCCGGAGACGACACGGCGGATCGCCGGCCTCTCGGACCAGGAGCCCGAG
GGGGTGGTGTCGGCGACCGTGCGGCTGTCGGACGACTTCGAGGAGGGCAGCGCACTGGAG
CACTACCACGCCGTGGTGACGGGGGCGGACGACGTGCCCGCGGACCTCGACGTGCTGGAC
TGCCCGGCCGGCACCTGGGCCGTGTTCGAGAACACCGGGCCCTTCCCGCAGGCACTGCAA
CAGATGTGGGCCGACGTGGCCGCCCACTGGATCCCCTCCAACCCCTACGAGTACCGGCCG
GGGCCGGAGATCCTGCGCGTCCGGCTGTGCCGGGACGACCCGGCCCGGTCCGACGCGCAC
CTGTGGATCCCCGTGACCCGCACCGCGACCCCCTCGGAGGTCGGATCGACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009057 Homeodomain-like (Domain)
 [3-55]  8.49999999999995e-18 G3DSA:1.10.10.60 [56-116]  1.8e-15 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
 [1-54]  1.49999977583352e-11 SSF46689 [55-119]  5.09999882439978e-12 SSF46689
SSF46689   Homeodomain_like
IPR010499 Bacterial transcription activator, effector binding (Domain)
 [126-285]  1.9e-18 PF06445
PF06445   GyrI-like
 [126-286]  1.39999892049878e-21 SM00871
SM00871   AraC_E_bind
IPR011256 Regulatory factor, effector, bacterial (Domain)
 [126-288]  1.70000295590054e-20 SSF55136
SSF55136   Bac_reg_effector
IPR018060 DNA binding HTH domain, AraC-type (Domain)
 [6-104]  PS01124
PS01124   HTH_ARAC_FAMILY_2
 [19-102]  1.99999636034521e-25 SM00342
SM00342   HTH_ARAC
SignalP No significant hit
TMHMM No significant hit