close all open/close all

CDS information : Lasal2_00470


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction101,038 / 104,343 / + [in whole cluster]
101,038 / 104,343 / + [in contig]
Location101038..104343 [in whole cluster]
101038..104343 [in contig]
TypeCDS
Length3,306 bp (1,101 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)glycoside hydrolase family 2, sugar binding
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF31

close this sectionSequence

selected fasta
>[glycoside hydrolase family 2, sugar binding]
MSPGRTRIPLFGRLVVLLPLLLGAALLTPAPAGAAPTAASPAPAAADGLGLRGDYYRMSS
GTALDFASYTGTRIDNSLHVDDLLPTLRTYAGTTDNVAVRWTGRLEVPADGAYTFYIKGD
NGFRMSLDGTSVINHWTTDWDVQTTSEAITLTAGLHDLVVDYNQGNGGAYLHTEWSGPGF
ARRPLSDSALHLPAGFAPADAKATVGRTGRTATVELPSALRSVPADAAKHLAVLSGGTLW
HPTVAKDAKNPAALVVTAGKDDTPVSLNADVRISYDGKGGVTTAQGDLGPFSVVAQNDST
WYFATPWAKDVSADNALPEYPRPQLTRNNWQNLNGTWQFQATAEDAALPTGKLTGKILVP
YPMESGLSGVARHHDWSLYQRTFSVPHGWKVGSGNRLRLNFGAVDHETWIYVNGKQVAHH
VGGYEEFSADVTDALSRRGQQTLLVKVKDTTDDKYAVGKQSANPSGIWYTPTSGIWQTVW
MEPVPEASVDSLVLTPDLTDDSLAVTVRPTATTPSSAKVTVTAYAGKRRVGSVTGRAGAA
LRLPVGKPHLWSPDDPYLYDLKVTLDGGRAGKDRVGSYFGMRSIKVAPVGGVNKILLNGK
PTFVMSTLDQGFWPDGLYTAPTDEALKSDLVAHKKLGFNAVRKHIKVEPARWYYWADRLG
LMVWQDMPSRMTAAAGTPETQTWIDQAHEIVDQHLSTPSIVMWTIMNEGWGEWSKAATGE
LADAVKKQDPSRLVDAHSGVNCCASKGDSGRGDVIDWHDYHGPANPAPDATRASVDGEHG
GYSYVVPGHILGTAGGQDYGDAATSTEELTKAYVENTRKLIQRASCGLSGSVYTQITDVE
GELNGLLTYDRKVVKVLPGPVREVNQQVIAAGAAAGGTDVPPGTPGLSGVSWWPLHQQSG
TVADDVTGGHDGTLEGGATWTTGPNGGAVQLDGSTGYVDAGAPVLDTEKGDYSVSARVRL
DDKGHFSTAVSLDGDRSSVFFLQYSQADKRFAFSFAGSRALANSIGEPQTGKWYHLVGSY
SHRDGTLRVYVDGTEAGSTRACNAEVPAGNLVIGRGKYNGAPVDHWAGALADVHAYDRAL
SAAEVASLAAHEPTAPTALKR
selected fasta
>[glycoside hydrolase family 2, sugar binding]
ATGAGCCCAGGCAGGACCCGAATACCCCTCTTCGGCCGACTCGTCGTGCTGCTGCCGCTG
TTGCTGGGGGCCGCGTTGCTGACGCCGGCCCCGGCCGGTGCCGCACCGACTGCGGCCTCC
CCGGCCCCGGCCGCCGCCGACGGCCTCGGACTGCGCGGCGACTACTACCGGATGTCCAGC
GGCACGGCGCTGGACTTCGCCTCGTACACCGGCACCCGCATCGACAACTCCCTGCACGTC
GACGACCTGTTGCCCACCCTGCGCACGTACGCCGGCACCACCGACAACGTCGCCGTGCGC
TGGACCGGCCGGCTCGAGGTGCCCGCGGACGGCGCCTACACCTTCTACATCAAGGGCGAC
AACGGCTTCCGGATGTCCCTCGACGGGACCAGTGTCATCAACCACTGGACCACCGACTGG
GACGTCCAGACCACCTCCGAGGCGATCACCCTGACCGCCGGACTGCACGACCTGGTGGTC
GACTACAACCAGGGCAACGGCGGCGCCTACCTGCACACCGAGTGGTCGGGCCCCGGCTTC
GCCCGCCGGCCGCTGTCGGACTCGGCGCTGCACCTGCCGGCCGGCTTCGCCCCGGCCGAC
GCCAAGGCGACGGTCGGCAGGACCGGGCGGACCGCCACCGTCGAACTGCCCTCCGCCCTC
AGGTCCGTGCCCGCTGACGCCGCCAAGCACCTCGCCGTGCTGTCCGGGGGCACCCTGTGG
CACCCCACGGTGGCCAAGGACGCCAAGAACCCCGCCGCCCTCGTGGTCACCGCCGGCAAG
GACGACACCCCCGTCTCGCTGAACGCCGACGTGCGGATCAGCTACGACGGCAAGGGCGGC
GTCACCACCGCCCAGGGCGACCTCGGACCGTTCTCCGTCGTCGCGCAGAACGACTCCACC
TGGTACTTCGCCACCCCGTGGGCCAAGGACGTCTCCGCCGACAACGCGCTGCCCGAGTAC
CCGAGGCCGCAGCTGACCCGGAACAACTGGCAGAACCTGAACGGCACCTGGCAGTTCCAG
GCGACCGCCGAGGACGCCGCGCTGCCCACCGGCAAGCTCACCGGGAAGATCCTGGTGCCG
TACCCGATGGAGTCGGGTCTGTCCGGTGTGGCCCGGCACCACGACTGGTCGCTGTACCAG
CGCACCTTCTCCGTGCCCCACGGCTGGAAGGTGGGGTCGGGCAACCGGCTGCGGCTCAAC
TTCGGCGCCGTGGACCACGAGACGTGGATCTACGTCAACGGCAAGCAGGTCGCCCACCAC
GTCGGCGGCTACGAGGAGTTCAGCGCCGACGTCACCGACGCCCTGTCCCGGCGCGGGCAG
CAGACGCTGCTGGTGAAGGTGAAGGACACCACGGACGACAAGTACGCCGTGGGCAAGCAG
TCGGCCAACCCGAGCGGCATCTGGTACACGCCGACCAGCGGCATCTGGCAGACCGTCTGG
ATGGAGCCGGTGCCCGAGGCGAGCGTCGACTCACTGGTCCTCACCCCGGACCTGACGGAC
GACTCGCTCGCCGTCACCGTGCGCCCCACCGCCACCACTCCGTCGTCCGCGAAGGTCACT
GTCACCGCCTACGCCGGGAAGCGGCGCGTGGGGTCGGTCACCGGGCGGGCCGGTGCCGCG
CTGCGCCTCCCGGTCGGCAAGCCGCACCTGTGGAGCCCGGACGACCCCTACCTGTACGAC
CTGAAGGTGACCCTCGACGGCGGACGGGCCGGGAAGGACCGGGTCGGTTCCTACTTCGGC
ATGAGGTCGATCAAGGTGGCCCCGGTGGGCGGCGTGAACAAGATCCTCCTCAACGGCAAG
CCCACCTTCGTGATGTCCACCCTGGACCAGGGGTTCTGGCCGGACGGCCTGTACACCGCG
CCCACCGACGAGGCCCTGAAGTCCGACCTGGTGGCACACAAGAAGCTCGGCTTCAACGCG
GTGCGCAAGCACATCAAGGTGGAGCCCGCGCGCTGGTACTACTGGGCCGACCGGCTCGGT
CTGATGGTGTGGCAGGACATGCCGAGCCGCATGACGGCCGCGGCGGGCACACCGGAGACG
CAGACCTGGATCGACCAGGCCCACGAGATCGTCGACCAGCACCTCAGCACCCCGTCGATC
GTCATGTGGACGATCATGAACGAGGGCTGGGGCGAGTGGAGCAAGGCCGCCACCGGTGAA
CTGGCCGACGCGGTCAAGAAGCAGGACCCGTCCCGGCTGGTGGACGCCCACTCCGGCGTC
AACTGCTGCGCCTCCAAGGGCGACTCGGGCCGCGGTGACGTCATCGACTGGCACGACTAC
CACGGCCCGGCCAACCCCGCTCCCGACGCCACCCGGGCCTCGGTCGACGGGGAGCACGGC
GGCTACTCGTACGTCGTTCCCGGCCACATCCTCGGCACCGCCGGCGGCCAGGACTACGGT
GACGCCGCCACCAGCACCGAGGAGTTGACCAAGGCGTACGTGGAGAACACCCGGAAGCTG
ATCCAGCGTGCCTCCTGCGGGCTCTCCGGTTCGGTCTACACCCAGATCACGGACGTGGAG
GGCGAGCTCAACGGCTTGCTGACCTACGACCGCAAGGTGGTCAAGGTGCTGCCCGGCCCG
GTCCGGGAGGTCAACCAGCAGGTGATCGCGGCCGGCGCCGCGGCGGGCGGCACGGACGTC
CCGCCGGGCACCCCGGGCCTGTCCGGGGTGTCCTGGTGGCCGCTGCACCAGCAGTCCGGC
ACGGTCGCCGACGACGTCACCGGCGGACACGACGGCACCCTCGAGGGCGGTGCGACGTGG
ACCACCGGCCCGAACGGCGGCGCGGTCCAGCTGGACGGCAGCACCGGTTACGTCGACGCC
GGCGCTCCCGTCCTGGACACCGAGAAGGGCGACTACTCGGTGTCCGCCCGGGTCCGGCTC
GACGACAAGGGCCACTTCAGCACCGCGGTGTCCCTGGACGGCGACCGCAGCAGCGTCTTC
TTCCTGCAGTACTCGCAGGCCGACAAGCGGTTCGCGTTCAGCTTCGCGGGCAGCCGGGCG
CTGGCCAACAGCATCGGCGAGCCGCAGACCGGCAAGTGGTACCACCTGGTGGGCAGTTAC
AGCCACCGCGACGGCACCCTGCGGGTCTACGTGGACGGCACCGAGGCGGGCTCCACCCGC
GCCTGCAACGCGGAGGTGCCCGCCGGGAACCTGGTGATCGGGCGCGGCAAGTACAACGGC
GCCCCGGTCGACCACTGGGCCGGCGCGCTCGCCGACGTCCACGCCTACGACCGTGCCCTG
AGCGCGGCCGAGGTGGCCTCCCTGGCCGCCCACGAGCCCACCGCACCCACCGCTCTCAAG
CGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006102 Glycoside hydrolase, family 2, immunoglobulin-like beta-sandwich (Domain)
 [487-583]  1.39999892049878e-17 SSF49303
SSF49303   Glyco_hydro_2Ig
 [489-582]  1.2e-10 PF00703
PF00703   Glyco_hydro_2
IPR006103 Glycoside hydrolase, family 2, TIM barrel (Domain)
 [622-738]  4.2e-11 PF02836
PF02836   Glyco_hydro_2_C
IPR006104 Glycoside hydrolase, family 2, N-terminal (Domain)
 [328-485]  4.00000000000001e-28 PF02837
PF02837   Glyco_hydro_2_N
IPR008979 Galactose-binding domain-like (Domain)
 [313-486]  1e-43 SSF49785
SSF49785   Gal_bind_like
IPR008985 Concanavalin A-like lectin/glucanase (Domain)
 [892-1094]  3.49999466863949e-36 SSF49899
SSF49899   ConA_like_lec_gl
IPR011658 PA14 (Domain)
 [89-182]  2.7e-20 PF07691
PF07691   PA14
 [60-188]  6.79998707392904e-23 SM00758
SM00758   PA14
IPR013320 Concanavalin A-like lectin/glucanase, subgroup (Domain)
 [892-1090]  1.2e-28 G3DSA:2.60.120.200
G3DSA:2.60.120.200   ConA_like_subgrp
IPR013781 Glycoside hydrolase, catalytic domain (Domain)
 [594-864]  5.30000000000001e-46 G3DSA:3.20.20.80
G3DSA:3.20.20.80   Glyco_hydro_cat
IPR013812 Glycoside hydrolase, family 2/20, immunoglobulin-like beta-sandwich domain (Domain)
 [475-583]  2.1e-23 G3DSA:2.60.40.320
G3DSA:2.60.40.320   Glyco_hydro_2/20_Ig-like
IPR017853 Glycoside hydrolase, superfamily (Domain)
 [586-866]  8.00002659346736e-49 SSF51445
SSF51445   Glyco_hydro_cat
SignalP
 [1-34]  0.771 Signal
Bacteria, Gram-positive   
 [1-34]  0.761 Signal
Eukaryota   
 [1-34]  0.89 Signal
Bacteria, Gram-negative   
TMHMM
 [13-35]  Transmembrane (i-o)
Transmembrane 1