close all open/close all

CDS information : Lasal2_00480


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction104,531 / 105,610 / + [in whole cluster]
104,531 / 105,610 / + [in contig]
Location104531..105610 [in whole cluster]
104531..105610 [in contig]
TypeCDS
Length1,080 bp (359 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)sugar ABC transporter, solute-binding protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF32

close this sectionSequence

selected fasta
>[sugar ABC transporter, solute-binding protein]
MTTSRRSRLVTAACLAATVVLAAGCAKEEGDDKASSDTGQGAQVVQTPSADPGTGCTLKT
YGATKIDLKNAVVGFSQSEKEANPFRIAETQSIKDEAAKLGVKKLLTTNAQSQLPKQISD
IQDMLAQGAQLLIVAPLNSDGLEPALQAAAAKHVPVITIDRKLNATACKDYVAFLGSDFV
EQGKRAADAMIKVTGGKGKVAILLGSSGNNVTTDRTKGFVDQLKAKAPGLQIVAQQTGEF
ARDKGQQVMEQLIQSKPDITAVYAENDEMGLGAVTALKGAGKEPGKDVKIISIDGTRNAV
QALANGQYNGVIESNPRFGPLAFATAQKFFDGGAIPEDVIISDRAYDASNAKSSVAGAY
selected fasta
>[sugar ABC transporter, solute-binding protein]
ATGACCACCTCGCGCAGATCCCGTCTCGTCACCGCCGCCTGCCTCGCCGCCACCGTCGTC
CTCGCCGCCGGCTGCGCCAAGGAGGAGGGCGACGACAAGGCTTCCTCCGACACCGGCCAG
GGCGCCCAGGTGGTGCAGACCCCGTCCGCCGACCCGGGCACGGGCTGCACCCTCAAGACG
TACGGCGCCACGAAGATCGACCTGAAGAACGCGGTCGTCGGCTTCTCGCAGTCCGAGAAG
GAGGCCAACCCCTTCCGCATCGCCGAGACGCAGTCCATCAAGGACGAGGCCGCCAAGCTG
GGCGTCAAGAAGCTGCTCACCACCAACGCGCAGTCCCAGCTGCCCAAGCAGATCAGCGAC
ATCCAGGACATGCTGGCCCAGGGCGCGCAGCTGCTCATCGTGGCGCCGCTGAACTCCGAC
GGCCTGGAGCCCGCGCTGCAGGCGGCCGCGGCCAAGCACGTGCCCGTGATCACCATCGAC
CGCAAGCTCAACGCCACCGCGTGCAAGGACTACGTGGCCTTCCTGGGCTCCGACTTCGTC
GAGCAGGGCAAGCGCGCGGCGGACGCGATGATCAAGGTGACCGGCGGCAAGGGCAAGGTC
GCGATCCTGCTCGGCTCCTCGGGCAACAACGTGACCACCGACCGCACGAAGGGGTTCGTC
GACCAGCTCAAGGCGAAGGCCCCCGGCCTGCAGATCGTGGCCCAGCAGACCGGCGAGTTC
GCCCGGGACAAGGGCCAGCAGGTGATGGAGCAGCTGATCCAGTCCAAGCCGGACATCACC
GCCGTGTACGCGGAGAACGACGAGATGGGCCTGGGTGCCGTCACGGCCCTCAAGGGGGCC
GGCAAGGAGCCCGGCAAGGACGTCAAGATCATCTCCATCGACGGGACCCGGAACGCCGTC
CAGGCCCTGGCCAACGGGCAGTACAACGGGGTGATCGAGTCCAACCCCCGGTTCGGGCCG
CTCGCCTTCGCCACCGCGCAGAAGTTCTTCGACGGCGGGGCCATCCCGGAGGACGTCATC
ATCTCCGACCGCGCCTACGACGCGTCCAACGCCAAGAGCTCCGTGGCCGGAGCCTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR025997 Periplasmic binding protein domain (Domain)
 [81-332]  9.09999999999992e-54 PF13407
PF13407   Peripla_BP_4
SignalP
 [1-22]  0.659 Signal
Bacteria, Gram-positive   
 [1-22]  0.851 Signal
Bacteria, Gram-negative   
 [1-22]  0.713 Signal
Eukaryota   
TMHMM No significant hit