close all open/close all

CDS information : Lasal2_00490


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction105,689 / 107,377 / + [in whole cluster]
105,689 / 107,377 / + [in contig]
Location105689..107377 [in whole cluster]
105689..107377 [in contig]
TypeCDS
Length1,689 bp (562 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)sugar uptake ABC transporter, ATP-binding protein
Gene
Gene (GenBank)rbsA
EC number3.6.3.17
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[sugar uptake ABC transporter, ATP-binding protein]
MAPSEAAIATPHPGADGAAPPAVLEAVGVGKRFAGVVALDDVSLTLRRGEIHALVGENGA
GKSTLIKVLTGVHRPDAGELRLGGEPVSFARPHEAQQAGVSTIYQEVNLVPMMSVARNIF
LGREPRNRLRLIDFPRMHREAADLLADFGVTADVRRPLNTLGVGTQQMVALARAVSVQAR
VVVMDEPTSALEPREVETLFRVIEDLHGRDIAILYVSHRMDELYRICERVTVLRDGRLVH
TGDLAGLDRTQLVSMMLGREVSEVRRHGVTQFGAGHDADREPVLTASKLSRRHLLEEVSL
QLRPGEVLGLGGLLGSGRTETAKALAGALPLDSGTVTVGGRELRRPSPAAAIRAGISLLS
EDRKAEGIVPGLSVRENIVLAAMPRLSRAGVVSRKQQDRIVQIFMERLRIKAAGPEQKVE
ELSGGNQQKVLLARWLCLEPKVLLLDEPTRGIDVGAKAEVQTLIDELAQEGLAVLLISSD
VEELVEGADRLVVLRGGAVAGELSGDLVNEADLLDALAAHPPEPPAPGAEPPASEPSAPE
PPASGPSADAPPSAPHTDKEQR
selected fasta
>[sugar uptake ABC transporter, ATP-binding protein]
ATGGCACCATCCGAAGCGGCCATCGCCACACCGCACCCGGGCGCCGACGGCGCCGCGCCG
CCCGCCGTCCTGGAGGCCGTCGGCGTCGGCAAACGCTTCGCGGGCGTGGTCGCGCTCGAC
GACGTCTCCCTGACCCTGCGCCGCGGTGAGATCCACGCCCTGGTCGGCGAGAACGGCGCG
GGCAAGTCCACCTTGATCAAGGTCCTCACCGGCGTGCACCGCCCCGACGCCGGCGAGTTG
CGCCTGGGCGGGGAGCCGGTGTCGTTCGCCCGGCCGCACGAGGCGCAGCAGGCGGGTGTG
TCCACCATCTACCAGGAGGTCAACCTCGTCCCGATGATGAGCGTGGCGCGGAACATCTTC
CTGGGCCGCGAGCCCAGGAACCGCCTGCGCCTGATCGACTTCCCCCGCATGCACCGCGAG
GCGGCCGACCTGCTGGCCGACTTCGGTGTCACGGCGGACGTCCGCCGTCCCCTGAACACC
CTGGGCGTGGGCACCCAGCAGATGGTGGCCCTGGCCCGGGCGGTCTCGGTGCAGGCGCGG
GTGGTGGTGATGGACGAGCCGACGTCCGCGCTCGAACCGCGCGAGGTGGAGACCCTGTTC
CGGGTCATCGAGGACCTGCACGGCCGGGACATCGCCATCCTCTACGTCAGCCACCGCATG
GACGAGCTGTACCGGATCTGCGAGCGGGTCACCGTGCTGCGCGACGGGCGGCTGGTGCAC
ACCGGCGACCTCGCCGGGCTGGACCGTACACAGTTGGTCTCGATGATGCTCGGACGGGAG
GTGTCCGAGGTGCGGCGGCACGGCGTCACCCAGTTCGGCGCCGGGCACGACGCCGACCGC
GAACCGGTGCTCACCGCATCAAAATTGAGCCGCCGTCACCTCCTGGAGGAGGTGTCCCTG
CAGCTGCGGCCGGGCGAAGTGCTCGGTCTCGGCGGCCTGTTGGGCTCCGGGCGCACGGAG
ACCGCCAAGGCCCTGGCCGGTGCCCTGCCGCTGGACTCCGGCACGGTGACGGTGGGGGGC
CGGGAGCTGCGCCGCCCGTCGCCCGCCGCGGCGATCCGCGCCGGCATCAGCCTGCTGAGC
GAGGACCGCAAGGCCGAGGGCATCGTGCCCGGTCTGTCGGTGCGGGAGAACATCGTGCTG
GCCGCGATGCCCCGCCTGTCCCGGGCCGGTGTCGTCTCCCGCAAGCAGCAGGACCGCATC
GTGCAGATCTTCATGGAGCGCCTGCGGATCAAGGCGGCCGGGCCCGAGCAGAAGGTGGAG
GAGCTCTCCGGCGGCAACCAGCAGAAGGTGCTGCTGGCCCGGTGGCTGTGCCTGGAGCCC
AAGGTGCTGCTGCTGGACGAGCCCACCCGTGGCATCGACGTCGGCGCCAAGGCCGAGGTG
CAGACCCTCATCGACGAACTGGCGCAGGAGGGGCTGGCCGTCCTGCTGATCTCCTCCGAC
GTCGAGGAGCTGGTGGAGGGCGCCGACCGGCTGGTGGTGCTGCGCGGCGGCGCGGTGGCC
GGTGAGCTGAGCGGCGACCTCGTCAACGAGGCCGACCTGCTCGACGCCCTGGCCGCCCAC
CCGCCCGAGCCGCCCGCCCCCGGCGCCGAACCGCCCGCCTCCGAGCCATCCGCCCCCGAG
CCACCCGCTTCCGGGCCGTCCGCCGACGCGCCGCCGTCGGCACCGCACACAGACAAGGAG
CAGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [63-189]  7.09999999999999e-19 PF00005 [322-449]  2.8e-15 PF00005
PF00005   ABC_tran
 [24-260]  PS50893 [278-521]  PS50893
PS50893   ABC_TRANSPORTER_2
IPR003593 AAA+ ATPase domain (Domain)
 [48-236]  3.70000251046782e-10 SM00382 [304-497]  4.99999811956429e-07 SM00382
SM00382   AAA
IPR017871 ABC transporter, conserved site (Conserved_site)
 [422-436]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP No significant hit
TMHMM No significant hit