close all open/close all

CDS information : Lasal2_00500


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction107,374 / 108,342 / + [in whole cluster]
107,374 / 108,342 / + [in contig]
Location107374..108342 [in whole cluster]
107374..108342 [in contig]
TypeCDS
Length969 bp (322 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)sugar uptake ABC transporter, permease protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF33

close this sectionSequence

selected fasta
>[sugar uptake ABC transporter, permease protein]
MTQLSPALGRRAVRLAAPAWFQKYGVYTAVAALLVYNAAFTDHFLTAANLRTQLVQVAPV
VIVALGMALVIGTEGVDLSVGSTMALAAALLPLYLGYGIVPALLVALVAGVVVGAVNGTL
VAVVGLQPIVATLALFVGGRGLALVMADGQLKQIENADLLALGSGEVLGIPDVVLIAGVL
ALVVAGVVHRTTFGRQLVAVGGNRAAARLAGLPVKRVLIGVYVLCGVLAALAGVLATARL
TASDPSALGNLMELSAITAVVVGGTPLTGGSVRVLGTVTGALLMQLLRATLVKHDLPDST
AQMAQAAIILIAVYVARERRSR
selected fasta
>[sugar uptake ABC transporter, permease protein]
ATGACGCAGCTGTCCCCGGCACTGGGACGCCGCGCGGTCCGGCTCGCCGCGCCGGCCTGG
TTCCAGAAGTACGGCGTCTACACCGCGGTGGCGGCGCTGCTCGTCTACAACGCCGCGTTC
ACCGACCACTTCCTGACCGCCGCCAACCTGCGCACCCAGCTGGTGCAGGTCGCCCCGGTC
GTCATCGTGGCGCTCGGCATGGCGCTGGTCATCGGCACCGAGGGCGTGGACTTGTCGGTG
GGCTCCACGATGGCGCTGGCCGCGGCGCTACTGCCGCTCTACCTCGGCTACGGCATCGTC
CCGGCCCTGCTCGTGGCGCTGGTGGCCGGTGTCGTGGTCGGCGCGGTCAACGGCACCCTG
GTCGCGGTGGTGGGCCTGCAACCCATCGTGGCGACCCTGGCGCTGTTCGTCGGCGGCCGG
GGGCTCGCCCTGGTGATGGCCGACGGACAGCTCAAGCAGATCGAGAACGCGGACCTGCTG
GCGCTGGGCAGCGGGGAGGTGCTGGGCATCCCCGACGTGGTGCTGATCGCCGGTGTACTG
GCCCTGGTGGTGGCCGGGGTCGTCCACCGCACCACCTTCGGCCGGCAGCTGGTCGCGGTG
GGCGGCAACCGGGCCGCCGCCCGGCTCGCCGGACTGCCCGTCAAGCGCGTCCTCATCGGC
GTCTACGTCCTGTGCGGCGTCCTCGCGGCCCTCGCCGGCGTGCTCGCCACGGCCCGGCTC
ACCGCGAGCGACCCCTCCGCGCTCGGCAACCTCATGGAGCTGTCCGCGATCACCGCGGTG
GTGGTCGGCGGCACCCCCCTGACCGGCGGCTCGGTACGGGTACTGGGCACCGTCACCGGA
GCGCTGCTGATGCAGCTGCTGCGGGCCACGCTGGTCAAGCATGACCTGCCGGACTCCACC
GCGCAGATGGCCCAGGCCGCCATCATCCTCATCGCCGTCTACGTCGCCCGGGAGCGTCGG
TCCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001851 ABC transporter, permease (Family)
 [54-313]  2.1e-41 PF02653
PF02653   BPD_transp_2
SignalP No significant hit
TMHMM
 [25-47]  Transmembrane (o-i) [54-76]  Transmembrane (i-o) [91-113]  Transmembrane (o-i) [120-142]  Transmembrane (i-o) [167-189]  Transmembrane (o-i) [217-239]  Transmembrane (i-o) [254-276]  Transmembrane (o-i)
Transmembrane 7