close all open/close all

CDS information : Lasal2_00510


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction108,339 / 109,364 / + [in whole cluster]
108,339 / 109,364 / + [in contig]
Location108339..109364 [in whole cluster]
108339..109364 [in contig]
TypeCDS
Length1,026 bp (341 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)sugar ABC transporter, permease protein
Gene
Gene (GenBank)rbsC
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[sugar ABC transporter, permease protein]
MKSLTTAPNLPAPPRPTQAPAPSATGRERIASLLQRHGAFAVLVALVLVSTFVFPSFGTL
DNAQNVAVQASFIAVVALGMTLVIITGGIDLSVGSVFALGGVLAAWASQYGFWAALLLPL
VVCGAIGTLNGLLIARAGMAPFIVTLATLLGARGLLLALTHEGATTYLVPRDSAFAELGQ
GTLGGFGYPVLVALALFAVGGVVLQRTSFGQSLFAVGGSADAATLMGLPVARTRVLVYLL
SGLLAGFAGALNAARLSSGVTIIGSGMELDAIAAVVIGGTLLTGGAGSVSGTLWGVLLLA
VIQNLINQIGSLNSSYQSVVSGGFLIVVVVAQRYLARARRT
selected fasta
>[sugar ABC transporter, permease protein]
ATGAAGTCACTCACCACTGCCCCGAACCTGCCGGCGCCGCCCCGCCCCACGCAGGCCCCC
GCCCCCTCTGCAACCGGCCGGGAACGGATCGCCTCGCTGCTGCAACGGCACGGCGCCTTC
GCCGTGCTGGTGGCCCTCGTCCTGGTCTCCACGTTCGTCTTCCCGTCCTTCGGCACCCTC
GACAACGCCCAGAACGTCGCCGTACAGGCGTCCTTCATCGCCGTCGTCGCGCTGGGCATG
ACGCTGGTCATCATCACCGGCGGCATCGACCTGTCGGTCGGCTCGGTGTTCGCGCTCGGC
GGCGTCCTGGCCGCCTGGGCCTCGCAGTACGGCTTCTGGGCCGCGCTGCTGCTGCCGCTC
GTCGTCTGCGGGGCCATCGGCACCCTCAACGGCCTGCTGATCGCCCGCGCCGGCATGGCC
CCGTTCATCGTCACCCTGGCCACCCTGCTGGGCGCCCGGGGCCTGCTGCTCGCCCTCACC
CACGAGGGCGCCACCACCTACCTGGTGCCGCGGGACTCGGCCTTCGCCGAGCTCGGCCAG
GGCACGCTCGGCGGCTTCGGGTACCCCGTGCTCGTCGCGCTGGCGCTGTTCGCCGTGGGC
GGGGTGGTGCTGCAGCGCACCTCGTTCGGGCAGTCGCTGTTCGCGGTGGGCGGCAGCGCC
GACGCCGCGACCCTGATGGGCCTGCCGGTGGCCCGCACCCGGGTGCTGGTCTACCTGCTC
AGCGGTCTGCTGGCCGGCTTCGCCGGCGCGCTCAACGCCGCCCGGCTCTCCTCCGGGGTG
ACGATCATCGGCTCGGGCATGGAGCTGGACGCGATCGCCGCGGTCGTCATCGGCGGCACG
CTGCTGACCGGCGGGGCCGGCTCGGTGAGCGGGACCCTGTGGGGGGTGCTGCTGCTGGCG
GTCATCCAGAACCTGATCAACCAGATAGGCTCGCTCAACTCGTCCTACCAGTCCGTGGTC
AGCGGCGGCTTCCTCATCGTGGTGGTCGTGGCCCAGCGGTACCTTGCCCGGGCACGCCGC
ACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000782 FAS1 domain (Domain)
 [144-183]  8.89999999999998e-05 G3DSA:2.30.180.10
G3DSA:2.30.180.10   BIgH3_FAS1
IPR001851 ABC transporter, permease (Family)
 [63-329]  2.19999999999997e-46 PF02653
PF02653   BPD_transp_2
SignalP No significant hit
TMHMM
 [38-60]  Transmembrane (o-i) [67-89]  Transmembrane (i-o) [111-133]  Transmembrane (o-i) [140-162]  Transmembrane (i-o) [182-204]  Transmembrane (o-i) [234-256]  Transmembrane (i-o) [271-302]  Transmembrane (o-i) [309-331]  Transmembrane (i-o)
Transmembrane 8