close all open/close all

CDS information : Lasal2_00520


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction109,429 / 110,445 / + [in whole cluster]
109,429 / 110,445 / + [in contig]
Location109429..110445 [in whole cluster]
109429..110445 [in contig]
TypeCDS
Length1,017 bp (338 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)LacI-family transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF34

close this sectionSequence

selected fasta
>[LacI-family transcriptional regulator]
MGVSLKDVAQRAGVSVKTVSNVVNDYPHVTPAMRARVQQAIDELGYRPNLTARHLRKGRT
GIIALAVPELGNPYFAELASAVIDAAARHHYTVLLDHTAGMREKEMLVCQGFQTHVIDGL
ILSPIELENQDLHGRTDTSPLVLLGEREYDAPYDHIAIDNVAAARSAVRHLIAIGRQRIA
FLGARAESARQPAHLRLRGWREELSAAGLPHDDSLVAPTDGYGRADGAQAMATLLDRGVR
PDAVFAYNDLQAIGAMRVLGERGLRVPQDVAVVGFDDIEESRFGAITLTTVAPDKQAIAR
QAVNCVISRLTDAAEAEPRRLRPGHDLVVRESTLGRHQ
selected fasta
>[LacI-family transcriptional regulator]
GTGGGCGTCAGCCTCAAAGACGTCGCGCAACGAGCGGGAGTCTCGGTCAAGACCGTCTCG
AACGTCGTCAACGACTATCCGCACGTCACCCCCGCGATGCGGGCCCGCGTCCAACAGGCG
ATCGACGAGCTCGGCTATCGCCCCAACCTCACCGCGCGCCACCTGCGCAAGGGCCGGACC
GGGATCATCGCGCTGGCCGTCCCGGAGCTCGGCAACCCCTACTTCGCGGAGCTGGCCAGC
GCGGTCATCGACGCGGCGGCCCGCCACCACTACACGGTGCTGCTGGACCACACCGCCGGC
ATGCGGGAGAAGGAGATGCTCGTCTGCCAGGGCTTCCAGACCCATGTGATCGACGGTCTG
ATCCTGTCCCCGATCGAGCTGGAGAACCAGGACCTGCACGGCCGCACCGACACCTCGCCG
CTCGTCCTGCTCGGCGAGCGCGAGTACGACGCCCCCTACGACCACATCGCGATCGACAAC
GTGGCCGCGGCGCGCAGCGCGGTGCGCCACCTGATCGCGATCGGGCGGCAGCGCATCGCG
TTCCTCGGCGCCCGCGCGGAGAGCGCCCGCCAGCCGGCCCACCTGCGCCTGCGCGGCTGG
CGGGAGGAGTTGTCCGCGGCCGGACTGCCGCACGACGACTCGCTGGTGGCCCCCACCGAC
GGCTACGGCCGGGCCGACGGCGCCCAGGCCATGGCCACGCTCCTGGACCGGGGTGTGCGG
CCCGACGCGGTCTTCGCCTACAACGACCTCCAGGCCATCGGCGCCATGCGGGTGCTCGGC
GAGCGCGGGCTGCGCGTCCCGCAGGACGTCGCGGTGGTGGGGTTCGACGACATCGAGGAG
AGCCGCTTCGGGGCCATCACCCTGACCACGGTCGCCCCCGACAAGCAAGCCATCGCCCGT
CAGGCGGTCAACTGCGTCATCTCCCGCCTGACCGACGCGGCCGAGGCCGAGCCACGGCGG
CTGCGCCCGGGCCACGACCTGGTGGTACGCGAGTCGACCCTGGGCCGCCACCAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000843 Transcription regulator HTH, LacI (Domain)
 [4-49]  4.6e-17 PF00356
PF00356   LacI
 [2-72]  4.00000300869883e-27 SM00354
SM00354   HTH_LACI
 [3-57]  PS50932
PS50932   HTH_LACI_2
 [5-23]  PS00356
PS00356   HTH_LACI_1
IPR010982 Lambda repressor-like, DNA-binding domain (Domain)
 [3-54]  2.1e-24 G3DSA:1.10.260.40
G3DSA:1.10.260.40   G3DSA:1.10.260.40
 [1-59]  4.19999771339581e-20 SSF47413
SSF47413   Lambda_like_DNA
SignalP No significant hit
TMHMM No significant hit