close all open/close all
Lasal2_00520 Lasal2_00520   last last

CDS information : Lasal2_00530


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction110,925 / 110,467 / - [in whole cluster]
110,925 / 110,467 / - [in contig]
Locationcomplement(110467..110925) [in whole cluster]
complement(110467..110925) [in contig]
TypeCDS
Length459 bp (152 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)AraC family transcriptional regulator
Gene
Gene (GenBank)adpA
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • containing an amidase domain and an AraC-type DNA-binding HTH domain

close this sectionSequence

selected fasta
>[AraC family transcriptional regulator]
SAVANTVARNLVVPPHRSGGQAQFVTRPVPDHDAHPLTALIPWVVERLDQPLTVEDLARR
AGMSSRHLTRHFRAATGTTPLQWLLAQRIRHAQELLEKTDDGIDGIAAATGMGTATTLRR
HFNRVVGVPPDTYRRTFRARTGPAPRAVPAPE
selected fasta
>[AraC family transcriptional regulator]
TCCGCCGTGGCCAACACGGTCGCCCGCAACCTGGTCGTCCCGCCGCACCGGTCCGGTGGC
CAGGCGCAGTTCGTCACCCGGCCCGTGCCCGACCACGACGCCCACCCGCTCACCGCCCTC
ATCCCCTGGGTCGTCGAGCGCCTCGACCAGCCCCTGACGGTGGAGGACCTGGCCCGCCGG
GCCGGCATGAGCTCGCGCCACCTCACCCGCCACTTCCGGGCGGCCACCGGCACCACACCG
CTGCAGTGGCTGCTCGCCCAGCGCATCCGCCACGCCCAGGAGCTCCTGGAGAAGACCGAC
GACGGCATCGACGGCATCGCCGCCGCCACGGGCATGGGGACCGCGACGACCCTGCGCCGC
CACTTCAACCGCGTCGTCGGCGTCCCCCCGGACACCTACCGCCGCACCTTCCGCGCCCGG
ACCGGGCCGGCTCCCCGGGCCGTTCCGGCACCCGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009057 Homeodomain-like (Domain)
 [30-87]  1.4e-23 G3DSA:1.10.10.60 [88-138]  2.7e-16 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
 [33-84]  9.80000272130218e-13 SSF46689 [87-148]  7.09999884211141e-10 SSF46689
SSF46689   Homeodomain_like
IPR018060 DNA binding HTH domain, AraC-type (Domain)
 [38-136]  PS01124
PS01124   HTH_ARAC_FAMILY_2
 [51-134]  1.29999924468179e-29 SM00342
SM00342   HTH_ARAC
IPR018062 HTH domain AraC-type, conserved site (Conserved_site)
 [88-130]  PS00041
PS00041   HTH_ARAC_FAMILY_1
SignalP No significant hit
TMHMM No significant hit
Lasal2_00520 Lasal2_00520   last last