close all open/close all
first first   Lasal_00020 Lasal_00020

CDS information : Lasal_00010


close this sectionLocation

Organism
StrainATCC 35851
Entry nameLasalocid
Contig
Start / Stop / Direction1,096 / 35 / - [in whole cluster]
1,096 / 35 / - [in contig]
Locationcomplement(35..1096) [in whole cluster]
complement(35..1096) [in contig]
TypeCDS
Length1,062 bp (353 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative endo-1,4-beta-xylanase
Product (GenBank)putative endo-1,4-b-xylanase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • orf1
Reference
ACC
PmId
[19129623] Identification of a gene cluster of polyether antibiotic lasalocid from Streptomyces lasaliensis. (Biosci Biotechnol Biochem. , 2009)
Related Reference
ACC
B2BZ80
PmId
[18027102] Biochemical characterization and sequence analysis of a xylanase produced by an exo-symbiotic bacterium of Gryllotalpa orientalis, Cellulosimicrobium sp. HY-12. (Antonie Van Leeuwenhoek. , 2008)
ACC
C6FX34
PmId
[19412576] Cloning of a new xylanase gene from Streptomyces sp. TN119 using a modified thermal asymmetric interlaced-PCR specific for GC-rich genes and biochemical characterization. (Appl Biochem Biotechnol. , 2010)

close this sectionSequence

selected fasta
>putative endo-1,4-beta-xylanase [putative endo-1,4-b-xylanase]
MTSSLALVPLAAAGSAAAAEAPAHGGKERTLRQLAADDRLRVGTAVDMSALADDTDYRRI
TGEQFSTVTPENVMKWEVIEPQRGVYDYAAADQLVAFAARHGQKVRGHTLVWHSQLPSWL
TTGDFTAQELRQILHRHITDTVRHFKGRIWQWDVVNEAFNDDGTLRDSIWLRKLGPGYIA
DAFRWAHEADPHAKLFYNDYNIEWSGPKSDAVLDLAGRLKAEGVPIDGVGFQGHLGIQYG
LPGGLPENFARFEKLGLDTAVTEADVRMVLPADDEKLATQAEGYRLLLDACLRTRHCISF
TVWGFTDRYSWVPGVFEGEGAANLLDEDYGVKPAFRAVQKALSGHARTKFGDA
selected fasta
>putative endo-1,4-beta-xylanase [putative endo-1,4-b-xylanase]
ATGACGTCGTCCCTCGCTCTCGTCCCCCTCGCCGCCGCCGGCTCGGCCGCCGCGGCCGAG
GCCCCGGCCCACGGCGGCAAGGAGCGAACGCTCCGCCAACTGGCGGCCGACGACCGGCTG
CGCGTCGGCACGGCCGTCGACATGTCGGCGCTCGCCGACGACACCGACTACCGCCGGATC
ACGGGTGAGCAGTTCTCCACCGTCACCCCGGAGAACGTCATGAAGTGGGAGGTGATCGAG
CCGCAGCGGGGCGTGTACGACTACGCCGCGGCCGACCAGCTGGTCGCGTTCGCCGCGCGG
CACGGGCAGAAGGTGCGGGGCCACACGCTGGTCTGGCACAGCCAGTTGCCCTCCTGGCTG
ACCACCGGCGACTTCACCGCCCAGGAGCTGCGCCAGATCCTGCACCGCCACATCACCGAC
ACCGTGCGGCACTTCAAGGGCCGCATCTGGCAGTGGGACGTCGTCAACGAGGCGTTCAAC
GACGACGGCACCCTGCGCGACTCGATCTGGCTGCGCAAGCTGGGCCCGGGGTACATCGCC
GACGCGTTCCGCTGGGCGCACGAGGCGGACCCGCACGCCAAGCTGTTCTACAACGACTAC
AACATCGAGTGGTCCGGCCCCAAGAGCGACGCCGTGCTCGACCTGGCCGGCCGCCTGAAG
GCCGAGGGCGTTCCCATCGACGGGGTCGGCTTCCAGGGGCACTTGGGCATCCAGTACGGG
CTGCCCGGCGGACTGCCCGAGAACTTCGCCCGCTTCGAGAAGCTGGGCCTGGACACCGCG
GTCACCGAGGCGGACGTCCGCATGGTCCTCCCGGCGGACGACGAGAAGCTGGCCACGCAG
GCCGAGGGCTACCGGCTGCTGCTGGACGCCTGCCTGCGCACCCGGCACTGCATCTCGTTC
ACCGTCTGGGGCTTCACCGACCGGTACTCCTGGGTGCCCGGCGTGTTCGAGGGCGAGGGC
GCCGCGAACCTCCTGGACGAGGACTACGGCGTGAAACCGGCCTTCCGCGCGGTCCAGAAG
GCGCTCTCGGGCCACGCCCGCACGAAGTTCGGCGACGCGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001000 Glycoside hydrolase, family 10 (Family)
 [105-117]  2.30000440726534e-19 PR00134 [149-160]  2.30000440726534e-19 PR00134 [193-204]  2.30000440726534e-19 PR00134 [222-234]  2.30000440726534e-19 PR00134
PR00134   GLHYDRLASE10
 [74-342]  3.30001976117415e-114 SM00633
SM00633   Glyco_10
 [32-341]  4.69999999999992e-98 PF00331
PF00331   Glyco_hydro_10
IPR013781 Glycoside hydrolase, catalytic domain (Domain)
 [32-343]  1.29999999999998e-118 G3DSA:3.20.20.80
G3DSA:3.20.20.80   Glyco_hydro_cat
IPR017853 Glycoside hydrolase, superfamily (Domain)
 [24-351]  6.80004680300024e-109 SSF51445
SSF51445   Glyco_hydro_cat
SignalP
 [1-18]  1 Signal
Bacteria, Gram-negative   
 [1-18]  1 Signal
Eukaryota   
 [1-18]  0.998 Signal
Bacteria, Gram-positive   
TMHMM No significant hit
first first   Lasal_00020 Lasal_00020