close all open/close all

CDS information : Lasal_00020


close this sectionLocation

Organism
StrainATCC 35851
Entry nameLasalocid
Contig
Start / Stop / Direction1,936 / 1,403 / - [in whole cluster]
1,936 / 1,403 / - [in contig]
Locationcomplement(1403..1936) [in whole cluster]
complement(1403..1936) [in contig]
TypeCDS
Length534 bp (177 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • orf2
Reference
ACC
PmId
[19129623] Identification of a gene cluster of polyether antibiotic lasalocid from Streptomyces lasaliensis. (Biosci Biotechnol Biochem. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MRTVELLVDDAADQVVREAWRRLADAGLPSQARHGSPTNSPHLTLAACPELTGPIRWELA
EVAAALPLPVRCTGLIRFERPTSVLAWALAPDPALTALHRRVWEAVASDSPPETLNPLHT
PGRWSPHITLGRTRRAGAFADRRIPGLLPMPPQSFLLTTLRSFDTHTGTLEVLEPRG
selected fasta
>hypothetical protein [hypothetical protein]
GTGCGTACGGTCGAGCTCCTGGTGGATGACGCGGCGGACCAGGTGGTCCGGGAGGCCTGG
CGGCGGCTGGCGGACGCGGGGCTGCCCAGTCAGGCCCGGCACGGCTCACCCACCAACAGC
CCGCACCTGACCCTGGCCGCCTGTCCGGAGCTGACCGGTCCGATCCGCTGGGAGCTCGCC
GAGGTGGCGGCCGCCCTCCCGCTCCCGGTGCGGTGCACGGGACTCATCCGCTTCGAGCGA
CCCACCTCCGTACTCGCCTGGGCGCTCGCACCGGACCCGGCGCTGACCGCCCTGCACCGC
CGGGTGTGGGAGGCGGTGGCCTCCGACAGTCCGCCCGAGACCCTCAACCCCCTGCACACG
CCGGGACGGTGGAGTCCGCACATCACCCTCGGCCGCACCCGGCGTGCGGGCGCCTTCGCC
GACCGGCGGATCCCCGGTCTGCTGCCCATGCCGCCGCAGTCCTTCCTGCTCACGACTCTG
CGCAGCTTCGACACCCACACCGGCACCCTGGAGGTGCTGGAGCCCCGCGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009097 RNA ligase/cyclic nucleotide phosphodiesterase (Domain)
 [4-132]  3.00000067992871e-08 SSF55144
SSF55144   Cyc_nuc_Pdiester
SignalP No significant hit
TMHMM No significant hit