close all open/close all

CDS information : Lasal_00030


close this sectionLocation

Organism
StrainATCC 35851
Entry nameLasalocid
Contig
Start / Stop / Direction2,817 / 2,116 / - [in whole cluster]
2,817 / 2,116 / - [in contig]
Locationcomplement(2116..2817) [in whole cluster]
complement(2116..2817) [in contig]
TypeCDS
Length702 bp (233 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)lsd1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19129623] Identification of a gene cluster of polyether antibiotic lasalocid from Streptomyces lasaliensis. (Biosci Biotechnol Biochem. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MNVRLAGVTAVTALALVTLPGTAGAAQAATQSADHGGHCVLDLTGRARVSCFDTFSGAIA
HATGGKVQLPAGATQVEGRYLTQLRQANSAALSSVAIGTLYNDANRKGHSWTITRSSDCD
ADPDIDWTYSNLSGVKAVAIGTLYNDANRKGHSWTITRSSDCDADPDIDWTYSNLSGVKD
ASGFDWNDEIGSAVQYGQCEAVYYEHSYFQGARVSGDWSGGALDDEVSSIAWS
selected fasta
>hypothetical protein [hypothetical protein]
ATGAACGTGCGACTCGCCGGCGTCACCGCCGTCACCGCGCTGGCTCTCGTCACCCTGCCG
GGCACCGCGGGTGCCGCCCAGGCCGCCACGCAGTCCGCCGACCACGGCGGGCACTGCGTG
CTGGACCTGACCGGCCGGGCCCGGGTCAGCTGCTTCGACACCTTCAGCGGCGCGATCGCC
CACGCGACCGGCGGCAAGGTGCAGCTGCCGGCCGGGGCGACCCAGGTCGAGGGCCGCTAC
CTGACCCAGCTCCGCCAGGCCAACTCCGCCGCCCTGAGTTCGGTGGCGATCGGCACGCTC
TACAACGACGCCAACCGCAAGGGCCACTCGTGGACCATCACCCGTTCCTCGGACTGCGAC
GCGGACCCGGACATCGACTGGACGTACAGCAACCTGTCGGGCGTGAAGGCGGTGGCGATC
GGCACGCTCTACAACGACGCCAACCGCAAGGGCCACTCGTGGACCATCACCCGTTCCTCG
GACTGCGACGCGGACCCGGACATCGACTGGACGTACAGCAACCTGTCGGGCGTGAAGGAC
GCCTCCGGGTTCGACTGGAACGACGAGATCGGCTCCGCCGTCCAGTACGGCCAGTGCGAG
GCGGTCTACTACGAGCACTCCTACTTCCAGGGCGCCCGGGTCAGCGGGGACTGGTCGGGA
GGTGCCCTGGACGACGAGGTGTCCTCCATCGCGTGGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-28]  1 Signal
Bacteria, Gram-negative   
 [1-25]  0.999 Signal
Eukaryota   
 [1-28]  1 Signal
Bacteria, Gram-positive   
TMHMM No significant hit