close all open/close all

CDS information : Lasal_00040


close this sectionLocation

Organism
StrainATCC 35851
Entry nameLasalocid
Contig
Start / Stop / Direction3,666 / 2,923 / - [in whole cluster]
3,666 / 2,923 / - [in contig]
Locationcomplement(2923..3666) [in whole cluster]
complement(2923..3666) [in contig]
TypeCDS
Length744 bp (247 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative IclR family transcriptional regulator
Product (GenBank)putative transcriptional regulator
Gene
Gene (GenBank)lsd2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19129623] Identification of a gene cluster of polyether antibiotic lasalocid from Streptomyces lasaliensis. (Biosci Biotechnol Biochem. , 2009)
Family/Domain
FD
IPR005471, IPR014757

close this sectionSequence

selected fasta
>putative IclR family transcriptional regulator [putative transcriptional regulator]
MRSGGNHMPQSPHRTASESSMGRGVLKGAFALLDELRRQGGEAGLTQIANACGLPKASTH
RLLHQLLMVGAVERHRGRYRVGGQLYRIGQAWQPHPGLRLAARQPLHGLRAATGASVVVT
VLYEDLALTIASVPGEVEPVAPVRDGMGFTLDTAAGQVLTAGPPRRAAGRPETALLEREQ
VMDGVCCAALPVCSPDGRLRAAITAMVPPHRRLQTVAEHTARAGAAITANLGRAARSTAP
LPPVLRH
selected fasta
>putative IclR family transcriptional regulator [putative transcriptional regulator]
ATGCGTTCCGGGGGGAACCACATGCCACAGTCACCGCACCGCACCGCGTCCGAGTCGTCG
ATGGGCCGAGGCGTCCTGAAGGGGGCGTTCGCACTGCTGGACGAGTTACGGCGGCAGGGG
GGCGAAGCGGGACTCACTCAGATCGCCAACGCCTGCGGGCTGCCCAAGGCGAGCACCCAC
CGGCTGCTGCACCAACTGCTCATGGTGGGCGCCGTCGAACGCCACCGCGGCCGCTACCGC
GTGGGCGGCCAGCTCTACCGGATCGGCCAGGCCTGGCAGCCCCATCCCGGACTGCGCCTG
GCCGCCCGCCAGCCCCTGCACGGGCTGCGCGCCGCCACCGGCGCCAGCGTCGTGGTCACC
GTCCTGTACGAGGACCTCGCGCTGACCATCGCCTCCGTGCCCGGCGAGGTCGAGCCGGTC
GCGCCGGTCCGCGACGGCATGGGCTTCACCCTGGACACCGCCGCGGGGCAGGTGCTCACG
GCCGGCCCGCCCCGCCGGGCGGCGGGCCGGCCGGAGACCGCCCTCCTGGAACGCGAGCAG
GTCATGGACGGGGTGTGCTGCGCGGCCCTCCCGGTGTGTTCGCCCGACGGTCGACTCCGC
GCGGCCATCACCGCGATGGTGCCGCCCCACCGACGGCTCCAGACCGTCGCCGAACACACC
GCCCGGGCCGGCGCCGCCATCACCGCCAACCTCGGCAGGGCCGCGAGGAGCACCGCTCCG
TTGCCGCCCGTGCTGCGCCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005471 Transcription regulator IclR, N-terminal (Domain)
 [23-83]  PS51077
PS51077   HTH_ICLR
 [29-75]  5e-13 PF09339
PF09339   HTH_IclR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [22-90]  1.4e-15 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR014757 Transcription regulator IclR, C-terminal (Domain)
 [84-247]  PS51078
PS51078   ICLR_ED
SignalP No significant hit
TMHMM No significant hit