close all open/close all

CDS information : Lasal_00050


close this sectionLocation

Organism
StrainATCC 35851
Entry nameLasalocid
Contig
Start / Stop / Direction3,871 / 4,899 / + [in whole cluster]
3,871 / 4,899 / + [in contig]
Location3871..4899 [in whole cluster]
3871..4899 [in contig]
TypeCDS
Length1,029 bp (342 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acyltransferase
Product (GenBank)putative 3-oxoacyl-(acyl carrier protein) synthase
Gene
Gene (GenBank)lsd3
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[19129623] Identification of a gene cluster of polyether antibiotic lasalocid from Streptomyces lasaliensis. (Biosci Biotechnol Biochem. , 2009)
Related Reference
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)
ACC
P68795
PmId
[11959561] Purification, characterization, and identification of novel inhibitors of the beta-ketoacyl-acyl carrier protein synthase III (FabH) from Staphylococcus aureus. (Antimicrob Agents Chemother. , 2002)

close this sectionSequence

selected fasta
>putative acyltransferase [putative 3-oxoacyl-(acyl carrier protein) synthase]
MTARRGPFGIGIRGTGSFLPVETVPNSVVAERAGVTADWIVRKTAIRERRYAAADEATSD
LAVAAAASALADAGVRAGDLAWIVVATSTPDQPQPATASLVQHRLGAEGAAVFDLNAVCS
GFVYALVTVAALLSGGTVGARRHGLVVGAEVYSRIIDPADRRTAVLFGDGAGAVVLGPVR
AGYGIVGSDLIGFGQHHDMIGVPAGGSRRPASQETLASGEHYFHMQGRAVRDFVTTELPA
GVRRLLTVCDIAPDAVDHFVPHQANGMMLREVLPLLGLPRARTHLTVAEHANTGAASVPL
ALDTVRRGGLLEDGDTVLLAGFGGGMSLGTALVRWDGAPGDG
selected fasta
>putative acyltransferase [putative 3-oxoacyl-(acyl carrier protein) synthase]
GTGACCGCTCGACGGGGACCTTTCGGCATCGGCATACGCGGCACGGGCTCCTTCCTGCCC
GTCGAGACGGTGCCCAACTCCGTCGTCGCCGAACGCGCCGGTGTGACGGCCGACTGGATC
GTGCGCAAGACCGCGATCCGCGAGCGCCGTTACGCCGCCGCCGACGAGGCGACCTCCGAC
CTGGCCGTGGCCGCCGCCGCGTCCGCCCTGGCCGACGCCGGCGTGCGGGCCGGGGATCTC
GCCTGGATCGTGGTGGCCACATCGACCCCGGATCAGCCGCAGCCGGCCACCGCGAGCCTC
GTGCAGCACCGGCTCGGTGCCGAGGGCGCGGCCGTCTTCGACCTCAACGCAGTGTGCAGC
GGCTTCGTGTACGCGCTGGTCACCGTGGCCGCGCTGCTCTCCGGCGGCACGGTGGGGGCA
CGGCGGCACGGCCTGGTCGTGGGTGCCGAGGTGTACTCGCGGATCATCGACCCCGCCGAC
CGGCGCACGGCGGTGCTGTTCGGGGACGGTGCGGGCGCGGTGGTGCTCGGTCCGGTGCGC
GCCGGGTACGGCATCGTGGGCTCGGACCTGATCGGGTTCGGGCAGCACCACGACATGATC
GGCGTTCCCGCGGGGGGCAGCCGCAGGCCGGCGTCGCAGGAGACACTCGCCTCGGGCGAG
CACTACTTCCACATGCAGGGGCGCGCCGTACGCGATTTCGTCACGACCGAACTCCCGGCA
GGCGTACGTCGGTTGCTCACCGTCTGCGACATCGCCCCGGACGCGGTGGACCACTTCGTC
CCGCACCAGGCCAACGGCATGATGCTGCGGGAGGTCCTGCCCCTGCTGGGACTGCCGCGG
GCACGCACCCACCTCACGGTGGCCGAGCATGCCAACACTGGTGCGGCGTCCGTGCCGTTG
GCGCTGGACACGGTCCGGCGCGGGGGCCTCTTGGAGGACGGGGACACGGTGCTGCTCGCC
GGGTTCGGCGGAGGAATGTCCCTCGGCACCGCGCTGGTGCGCTGGGACGGGGCGCCCGGG
GACGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004655 Beta-ketoacyl-acyl carrier protein synthase III (FabH) (Family)
 [1-335]  32.896 MF_01815
MF_01815   FabH
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [250-335]  4.3e-27 PF08541
PF08541   ACP_syn_III_C
IPR013751 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (Domain)
 [113-190]  9.4e-24 PF08545
PF08545   ACP_syn_III
IPR016038 Thiolase-like, subgroup (Domain)
 [9-169]  2.4e-46 G3DSA:3.40.47.10 [170-335]  1.8e-40 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [9-335]  9.1e-47 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-30]  0.255 Signal
Bacteria, Gram-positive   
 [1-30]  0.172 Signal
Eukaryota   
TMHMM No significant hit