close all open/close all

CDS information : Lasal_00060


close this sectionLocation

Organism
StrainATCC 35851
Entry nameLasalocid
Contig
Start / Stop / Direction5,697 / 4,918 / - [in whole cluster]
5,697 / 4,918 / - [in contig]
Locationcomplement(4918..5697) [in whole cluster]
complement(4918..5697) [in contig]
TypeCDS
Length780 bp (259 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)putative type II thioesterase
Gene
Gene (GenBank)lsd4
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
Reference
ACC
PmId
[19129623] Identification of a gene cluster of polyether antibiotic lasalocid from Streptomyces lasaliensis. (Biosci Biotechnol Biochem. , 2009)
Related Reference
ACC
B5M9K2
NITE
Lasal2_00100
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)
ACC
Q7BUF9
NITE
Rifam_00540
PmId
[19103602] Structure and functional analysis of RifR, the type II thioesterase from the rifamycin biosynthetic pathway. (J Biol Chem. , 2009)

close this sectionSequence

selected fasta
>putative type II thioesterase [putative type II thioesterase]
MVNVVRGAARLSTSVGSGTWIRQYRTAGPGAPRLVCFPHAGGSASFYFPVATALSPDVDV
LAVQYPGRQDRMGEQPLTDLRRLADQVAEALEPWRDQPLHLFGHSMGAVIAYEVALRLQQ
SPGPGPAALYVSGRRAPSTRRTETVHLRDDAGLIRELKTLAGTDAALLADDDVLAMILPA
LRADYRAIETYEHRPAPLLTCPVTALLGDADPKVTLAEAEVWREHTDEDFDLHVFPGGHF
YLTTHQPAVLTLLRERLKA
selected fasta
>putative type II thioesterase [putative type II thioesterase]
ATGGTGAACGTCGTAAGGGGGGCGGCCCGGTTGAGTACATCGGTGGGCAGCGGTACGTGG
ATACGGCAGTACCGCACGGCCGGGCCGGGGGCGCCCCGTCTGGTGTGCTTCCCGCACGCC
GGAGGCTCGGCCAGCTTCTACTTCCCCGTGGCCACCGCGCTCAGCCCGGACGTCGACGTC
CTCGCGGTGCAGTACCCCGGCCGGCAGGACCGCATGGGGGAGCAGCCGCTCACGGACCTG
CGGCGCCTCGCCGACCAGGTCGCCGAGGCACTCGAGCCCTGGCGCGACCAGCCCCTGCAC
CTCTTCGGACACAGCATGGGCGCCGTCATCGCCTACGAGGTCGCCCTGCGTCTCCAGCAG
TCCCCGGGTCCCGGCCCGGCCGCGCTCTACGTGTCCGGCCGGCGCGCCCCCTCCACCCGG
CGCACCGAGACCGTGCACCTGAGGGACGACGCCGGTCTGATCCGTGAGCTGAAGACACTC
GCCGGGACGGACGCGGCCCTGCTCGCCGACGACGACGTCCTCGCCATGATCCTGCCGGCG
CTGCGCGCCGACTACCGGGCGATCGAGACGTACGAGCACCGCCCGGCGCCCCTGCTCACC
TGCCCGGTGACCGCCCTGCTGGGCGACGCCGACCCCAAGGTCACGCTCGCCGAGGCCGAG
GTGTGGCGGGAGCACACCGACGAGGACTTCGACCTGCACGTGTTCCCGGGCGGCCACTTC
TACCTGACGACCCACCAGCCGGCCGTGCTGACCCTGCTCCGGGAGCGTCTGAAGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [33-254]  2.19999999999997e-62 PF00975
PF00975   Thioesterase
SignalP No significant hit
TMHMM No significant hit