close all open/close all

CDS information : Lasal_00070


close this sectionLocation

Organism
StrainATCC 35851
Entry nameLasalocid
Contig
Start / Stop / Direction7,438 / 5,870 / - [in whole cluster]
7,438 / 5,870 / - [in contig]
Locationcomplement(5870..7438) [in whole cluster]
complement(5870..7438) [in contig]
TypeCDS
Length1,569 bp (522 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)putative resistance protein
Gene
Gene (GenBank)lsd5
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19129623] Identification of a gene cluster of polyether antibiotic lasalocid from Streptomyces lasaliensis. (Biosci Biotechnol Biochem. , 2009)
Related Reference
ACC
B5M9K3
NITE
Lasal2_00110
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)
ACC
O52557
NITE
Rifam_00370
PmId
[17351715] RifP; a membrane protein involved in rifamycin export in Amycolatopsis mediterranei. (Biotechnol Lett. , 2007)

close this sectionSequence

selected fasta
>putative drug resistance transporter [putative resistance protein]
MEAVMSVSDARRWWAVGALALSALVVGLDTTVLNVALPTLATDLEASTSELQWFANAYNL
VFAAVLLPAGLSGDRYGRKKLLVVALVLFGAASVGCAYSGSTDALIWWRALLGLGAGFIF
PLSLSVLPVMFSDEERPKAIGMVVTASALGLPLGPIVGGWLLDNFWWGSVFLINVPMVAL
AIVAVLLLLPDSRSPEPPGLDLVGVLLSSAGLAGITYGAIKAGEKSWGDGTALTMLIGGV
VLMLLFVVWQRHLAARPDGKPLVDLSLFRSPAFTWGAVMATVVSFALFGLLFTVPQYYQA
VLGADALGTGLRLLPIIGGIIVGARVGGKVTAKAGPKRLVSVGFLLMAVGLFMGAVTDTD
TSYGYAATWIAVVGLGTGLALPLAVDSALGALSTERSGVGSAVIQTVRQVGGTIGVALLG
TILTSSYHSHLEVGSIPDRAADAAGESVSAGVLVAQKLHSPALLSSVQESFVHGMNVMLV
VCGAIAVVGTVLAALFMPQQAKREQPGTDPVAPADAQPRGAL
selected fasta
>putative drug resistance transporter [putative resistance protein]
ATGGAGGCCGTCATGAGCGTCTCGGATGCCCGACGATGGTGGGCGGTGGGCGCCCTGGCG
TTGAGTGCGCTGGTGGTGGGCCTGGACACGACGGTCCTGAACGTCGCCCTGCCCACGCTC
GCCACCGACCTGGAGGCCTCGACCAGCGAACTGCAGTGGTTCGCCAACGCCTACAACCTG
GTCTTCGCCGCGGTGCTGCTGCCGGCGGGGCTCTCCGGTGACCGCTATGGCCGCAAGAAG
CTGCTCGTGGTGGCACTGGTCCTGTTCGGCGCCGCCTCCGTCGGCTGCGCCTACTCCGGC
TCCACGGACGCCCTGATCTGGTGGCGCGCCCTGCTCGGCCTGGGCGCCGGGTTCATCTTC
CCGCTGTCCCTGTCGGTGCTCCCCGTGATGTTCTCCGACGAGGAGCGACCGAAGGCGATC
GGCATGGTCGTGACCGCCAGCGCGCTCGGGCTCCCGCTCGGCCCGATCGTCGGCGGCTGG
CTGCTGGACAACTTCTGGTGGGGCTCGGTCTTCCTCATCAACGTCCCCATGGTCGCCCTC
GCGATCGTCGCCGTCCTGCTGCTGCTGCCCGACTCCCGCAGCCCGGAACCTCCGGGGCTC
GACCTGGTGGGCGTCCTGCTCTCCAGCGCCGGCCTCGCCGGCATCACTTACGGGGCCATC
AAGGCCGGCGAGAAGAGCTGGGGCGACGGCACGGCCCTCACGATGCTGATCGGCGGCGTG
GTCCTGATGCTGCTGTTCGTCGTGTGGCAGCGCCATCTCGCGGCGCGCCCCGACGGCAAG
CCCCTGGTCGACCTCTCGCTCTTCAGGTCACCCGCGTTCACCTGGGGCGCGGTGATGGCC
ACAGTCGTGTCGTTCGCCCTGTTCGGACTGCTGTTCACCGTGCCGCAGTACTACCAGGCC
GTCCTCGGCGCCGACGCCCTCGGCACGGGACTGCGGCTGCTGCCGATCATCGGCGGCATC
ATCGTCGGCGCCCGGGTGGGCGGCAAGGTCACCGCCAAGGCGGGGCCCAAGCGGCTGGTC
TCCGTGGGCTTCCTGCTGATGGCCGTCGGACTGTTCATGGGAGCGGTGACCGACACCGAC
ACCTCCTACGGCTACGCGGCCACCTGGATCGCCGTCGTCGGCCTCGGCACGGGCCTCGCG
CTCCCCCTGGCCGTCGACTCGGCGCTCGGCGCGCTGTCGACCGAACGCAGCGGCGTCGGC
TCCGCCGTGATCCAGACGGTCCGCCAGGTCGGCGGCACCATCGGCGTGGCGCTCCTCGGC
ACCATCCTGACCTCCTCCTACCACAGCCACCTGGAGGTGGGTTCGATCCCCGACCGGGCC
GCGGACGCGGCAGGGGAGAGCGTTTCCGCCGGCGTCCTCGTCGCGCAGAAGCTGCACTCG
CCCGCCCTGCTCTCCAGCGTGCAGGAGTCGTTCGTCCACGGCATGAACGTGATGCTGGTC
GTCTGCGGCGCCATCGCCGTCGTCGGCACCGTGCTCGCGGCGCTGTTCATGCCGCAGCAG
GCGAAGCGGGAGCAGCCGGGCACCGACCCCGTCGCCCCGGCCGACGCCCAGCCGCGGGGC
GCGCTCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004638 Drug resistance transporter EmrB/QacA subfamily (Family)
 [17-494]  3.30000000000002e-80 TIGR00711
TIGR00711   Efflux_EmrB
IPR011701 Major facilitator superfamily (Family)
 [19-415]  7.20000000000003e-54 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-506]  1.79999754022378e-80 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [15-501]  PS50850
PS50850   MFS
SignalP
 [1-27]  0.926 Signal
Eukaryota   
TMHMM
 [13-35]  Transmembrane (i-o) [50-72]  Transmembrane (o-i) [81-100]  Transmembrane (i-o) [105-127]  Transmembrane (o-i) [140-162]  Transmembrane (i-o) [167-189]  Transmembrane (o-i) [202-220]  Transmembrane (i-o) [230-249]  Transmembrane (o-i) [272-294]  Transmembrane (i-o) [309-328]  Transmembrane (o-i) [340-357]  Transmembrane (i-o) [367-389]  Transmembrane (o-i) [410-427]  Transmembrane (i-o) [474-496]  Transmembrane (o-i)
Transmembrane 14