close all open/close all

CDS information : Lasal_00080


close this sectionLocation

Organism
StrainATCC 35851
Entry nameLasalocid
Contig
Start / Stop / Direction7,654 / 8,043 / + [in whole cluster]
7,654 / 8,043 / + [in contig]
Location7654..8043 [in whole cluster]
7654..8043 [in contig]
TypeCDS
Length390 bp (129 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)lsd6
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19129623] Identification of a gene cluster of polyether antibiotic lasalocid from Streptomyces lasaliensis. (Biosci Biotechnol Biochem. , 2009)
Related Reference
ACC
B5M9K4
NITE
Lasal2_00120
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MPARVFVALFASDSDHLTAGELAEQLQVSPAAISGAVRYLTQVNLAIREREPGARQDHFR
VDGNVWYELMRRRDRELVRWEDSLREGVETLGRDTPAGAKLAATLPFFEFMQKELSEMLE
RWRQQEGNS
selected fasta
>hypothetical protein [hypothetical protein]
ATGCCCGCCCGGGTCTTCGTCGCCCTGTTCGCCTCGGACTCCGATCACCTGACCGCCGGC
GAGCTCGCCGAGCAGCTCCAGGTGAGCCCCGCGGCCATCTCGGGCGCCGTGCGGTACCTG
ACGCAGGTGAACCTGGCCATCCGGGAGCGTGAACCGGGCGCCCGCCAGGACCACTTCCGG
GTGGACGGCAACGTCTGGTACGAGCTCATGCGCCGCCGTGACCGCGAACTCGTCCGCTGG
GAGGACAGCCTGCGCGAGGGTGTCGAGACCCTCGGCAGGGACACCCCCGCCGGGGCGAAG
CTCGCGGCGACACTGCCCTTCTTCGAGTTCATGCAGAAGGAGTTGTCGGAAATGCTGGAG
CGCTGGCGTCAGCAGGAGGGAAATTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [4-59]  7.5e-09 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP
 [1-20]  0.82 Signal
Eukaryota   
TMHMM No significant hit