close all open/close all

CDS information : Lasal_00100


close this sectionLocation

Organism
StrainATCC 35851
Entry nameLasalocid
Contig
Start / Stop / Direction8,611 / 11,334 / + [in whole cluster]
8,611 / 11,334 / + [in contig]
Location8611..11334 [in whole cluster]
8611..11334 [in contig]
TypeCDS
Length2,724 bp (907 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)putative transcriptional regulator
Gene
Gene (GenBank)lsd8
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19129623] Identification of a gene cluster of polyether antibiotic lasalocid from Streptomyces lasaliensis. (Biosci Biotechnol Biochem. , 2009)
Related Reference
ACC
B5M9K5
NITE
Lasal2_00130
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)
ACC
Q9S0N8
NITE
Aver_00010
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[19148632] Characterization of a regulatory gene, aveR, for the biosynthesis of avermectin in Streptomyces avermitilis. (Appl Microbiol Biotechnol. , 2009)
[20012992] The pathway-specific regulator AveR from Streptomyces avermitilis positively regulates avermectin production while it negatively affects oligomycin biosynthesis. (Mol Genet Genomics. , 2010)

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [putative transcriptional regulator]
MESVEQQTEWRTLHTAFDDAASGISRTVLIEAGVACGKSTVLEGIGDYTAARGALVLHAV
GSLSGSGTPLGVVRQLVEYPSFPATAGQNLLADVERGDYAQFSAALRNIAVRLPVVVSVD
DLHHVDAASLHCLLHLVGHTRRSRILTLFTQSLSCAPQDPTFDTELLRQPNFRRVRLAPL
DLHGVTAMLANHPEVDAGEDLTRELHSVSGGNPLLLRALIEDHLAARRFAGPSGERAEPG
VAFSRAVLTCLHRGGSRMRDAATALAVLGESEHTALLGPLAGLSAAALAQARHALDATGI
TAEHRFRHRLARAAVLDSITPADRRALHLKAATLLHRHGASVREVAAHLLAGGGTPDAWG
VTALKEAAEEALAADRAQEAVAFLELAHAGSTDARTRAEITVRLACVMWRLNPATAESLY
LAESLSALWSGLLPVPFIAPLANLLVAHGRLDEARHVLGRLQESTGPGQALPADTEIMHP
WEWDVHFPHALAPATPATSGRDIRLLSSHGGRPDPVHATGIERFLRVSPLTDTTLTAVTT
AIKSLIHHDRVDLAESWCDAFLQEAERRDAPGWEVLFASLRAEIALHQGRLTDAEQYADR
ALAAVPEHTGVFFIGGPLSSLVLAYTAMGDYESAARRLNQSVPEALFKNVYGLRYLRARG
RYYLATNRAHTALGDFLDAGRLAARWGVDRPTLLPWRSDAAEAWLELGNPEQAERLITDQ
LQMRDAINSRVRGISLRLRAMTADAKVRPRLLTKAVEALQTSGDRLEMARVLDALGDAQQ
ALGDTTRAAAAKRRARHMARECGATAWGGAPQSTASRSVPASRRHWSAEGHAPSALTKLS
ESEKRVAALAACGYTNRDISAKLYITVSTVEQHLTRVYRKLHISRREQLPPDLQFSPYEN
DCQSIAT
selected fasta
>putative LuxR family transcriptional regulator [putative transcriptional regulator]
ATGGAATCCGTTGAACAGCAAACAGAATGGCGTACGCTTCACACAGCATTCGACGACGCG
GCGTCCGGAATATCCCGGACGGTACTGATAGAAGCCGGAGTCGCCTGCGGGAAAAGCACG
GTTCTGGAGGGAATCGGCGACTACACCGCGGCCCGGGGCGCCTTGGTCCTGCACGCCGTG
GGCTCGTTGTCCGGCAGCGGAACACCGCTCGGCGTCGTACGCCAACTCGTCGAATACCCT
TCATTCCCCGCAACCGCCGGCCAAAACCTCCTCGCGGACGTGGAAAGGGGAGATTACGCA
CAGTTCTCCGCAGCGCTGCGGAATATAGCCGTCCGCTTACCGGTGGTGGTGAGCGTAGAC
GACCTGCACCACGTGGACGCCGCCTCCTTGCACTGCCTCCTCCACCTCGTCGGCCACACC
CGCCGGAGCAGGATTCTCACCCTGTTCACCCAGTCGTTGTCGTGCGCTCCCCAAGACCCC
ACGTTCGACACCGAATTGCTGCGCCAGCCCAATTTCCGCAGGGTCCGGCTCGCCCCGCTC
GACCTGCACGGCGTGACCGCGATGCTCGCGAACCACCCCGAGGTCGACGCCGGCGAGGAC
CTGACGCGGGAACTGCACTCCGTCAGCGGGGGGAACCCGCTGCTGCTGCGCGCGCTGATC
GAGGACCACCTGGCGGCCCGCCGCTTCGCGGGTCCGTCGGGTGAACGCGCCGAGCCCGGC
GTCGCGTTCAGCCGGGCCGTGCTCACCTGTCTGCACCGGGGCGGCAGCCGCATGCGTGAC
GCCGCCACCGCCCTGGCCGTTCTGGGCGAGTCCGAGCACACCGCCCTGCTGGGCCCCCTT
GCGGGCCTGTCGGCGGCGGCGCTCGCCCAGGCCCGGCACGCCCTCGACGCCACCGGCATC
ACCGCGGAGCACCGCTTCCGCCACCGCCTGGCCAGAGCCGCCGTGCTGGACAGCATCACC
CCCGCGGACCGGCGCGCCCTGCACCTGAAGGCCGCGACCCTGTTGCACCGGCACGGCGCC
TCCGTCCGCGAGGTCGCCGCCCACCTGCTCGCCGGCGGCGGCACGCCGGACGCCTGGGGA
GTCACCGCACTCAAGGAGGCGGCCGAGGAGGCACTCGCCGCCGACCGGGCACAGGAGGCG
GTCGCCTTCCTGGAGCTGGCCCACGCCGGTTCCACCGACGCCCGTACCCGGGCGGAGATC
ACCGTCCGGCTCGCCTGCGTCATGTGGCGCCTCAACCCGGCCACCGCGGAGAGCCTGTAC
CTGGCGGAGTCCCTCTCCGCCCTGTGGTCCGGGCTGCTGCCGGTGCCCTTCATCGCGCCG
CTGGCCAACCTGCTCGTCGCCCACGGCCGCCTCGATGAGGCACGTCACGTCCTCGGCCGG
CTGCAGGAGTCGACCGGTCCCGGCCAGGCCCTGCCGGCGGACACCGAGATCATGCACCCC
TGGGAGTGGGACGTGCACTTCCCCCACGCCCTGGCGCCGGCCACTCCGGCGACGTCCGGC
CGGGACATCCGTCTGCTGAGCTCGCACGGCGGCCGGCCCGATCCCGTCCACGCCACGGGG
ATCGAGCGGTTCCTGCGGGTGTCGCCGCTGACCGACACCACCCTCACCGCCGTCACCACG
GCGATCAAGTCGCTCATCCACCACGACCGCGTGGACCTGGCCGAGAGCTGGTGCGACGCC
TTCCTGCAGGAGGCCGAGCGGCGCGACGCCCCCGGTTGGGAGGTGCTGTTCGCCTCCCTG
CGCGCCGAGATCGCGCTGCACCAGGGCCGGCTCACCGACGCCGAACAGTACGCCGACCGC
GCGCTGGCGGCCGTCCCGGAGCACACCGGGGTGTTCTTCATCGGCGGTCCCCTGTCCAGC
CTGGTGCTGGCGTACACCGCGATGGGCGACTACGAGTCCGCGGCCCGACGGCTCAACCAG
TCGGTGCCCGAAGCGCTGTTCAAGAACGTGTACGGACTGCGCTACCTGCGCGCCCGGGGA
CGCTACTACCTGGCCACCAACCGGGCGCACACCGCCCTGGGCGACTTCCTCGACGCCGGC
CGGCTCGCCGCGCGCTGGGGCGTCGACCGTCCCACGCTGCTGCCGTGGCGCTCGGACGCC
GCCGAGGCCTGGCTCGAACTGGGCAACCCGGAACAGGCCGAGCGGCTGATCACCGACCAG
CTCCAGATGCGCGACGCGATCAACTCCCGGGTGCGGGGCATCTCGCTGCGGCTACGCGCG
ATGACCGCGGACGCCAAGGTGCGCCCACGACTGCTCACCAAGGCGGTGGAAGCCCTGCAG
ACGTCCGGGGACCGGCTGGAGATGGCCCGCGTCCTGGACGCCCTGGGCGACGCGCAGCAG
GCCCTGGGCGACACCACCCGGGCCGCCGCGGCCAAGCGCCGGGCCCGCCACATGGCCCGC
GAGTGCGGAGCCACGGCGTGGGGCGGCGCTCCGCAGTCCACCGCCTCCCGGTCTGTGCCG
GCCTCACGGCGGCACTGGTCGGCCGAGGGACACGCGCCGTCCGCCCTCACCAAGCTCAGC
GAGTCGGAGAAGCGGGTGGCCGCCCTGGCCGCCTGCGGATACACCAACCGCGACATATCG
GCCAAGCTGTACATCACCGTCAGCACGGTCGAGCAGCACCTCACCCGGGTCTACCGGAAG
CTGCACATCTCACGCCGTGAACAGCTGCCGCCCGACCTCCAGTTCAGCCCGTACGAGAAC
GACTGCCAGTCCATCGCCACGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [853-880]  PS00622
PS00622   HTH_LUXR_1
 [839-853]  4.60000044330862e-08 PR00038 [853-869]  4.60000044330862e-08 PR00038 [869-881]  4.60000044330862e-08 PR00038
PR00038   HTHLUXR
 [836-893]  5.59999989417023e-19 SM00421
SM00421   HTH_LUXR
 [838-889]  4.40000000000001e-09 PF00196
PF00196   GerE
IPR011990 Tetratricopeptide-like helical (Domain)
 [544-847]  1.4e-17 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [848-889]  4.9e-16 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [817-889]  1e-13 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit