close all open/close all

CDS information : Lasal_00120


close this sectionLocation

Organism
StrainATCC 35851
Entry nameLasalocid
Contig
Start / Stop / Direction14,560 / 12,833 / - [in whole cluster]
14,560 / 12,833 / - [in contig]
Locationcomplement(12833..14560) [in whole cluster]
complement(12833..14560) [in contig]
TypeCDS
Length1,728 bp (575 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative 3-hydroxyacyl-CoA dehydrogenase
putative beta-keto-reductase
Product (GenBank)putative 3-hydroxybutyryl-CoA dehydrogenase
Gene
Gene (GenBank)lsd10
EC number1.1.1.35
Keyword
  • ethylmalonyl-CoA
Note
Note (GenBank)
Reference
ACC
PmId
[19129623] Identification of a gene cluster of polyether antibiotic lasalocid from Streptomyces lasaliensis. (Biosci Biotechnol Biochem. , 2009)
Related Reference
ACC
B5M9K7
NITE
Lasal2_00150
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)
ACC
P52041
PmId
[8655474] Cloning, sequencing, and expression of clustered genes encoding beta-hydroxybutyryl-coenzyme A (CoA) dehydrogenase, crotonase, and butyryl-CoA dehydrogenase from Clostridium acetobutylicum ATCC 824. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>putative 3-hydroxyacyl-CoA dehydrogenase [putative 3-hydroxybutyryl-CoA dehydrogenase]
MGMAQQRFPTVAVVGLGITGSALMTLLARTGHRVVAVDVDEAALERARDRARAAGVEGVD
FTTRFADVARADLLVEAVPEQLEAKRQVLRRAHEVCPGATVFATTTTSLSVTGLAFESGR
MASTIGLHFFPTAPENGLGAVELIATPVTARALLDDVRELLHGLGSTAVSSTDSPGFVGG
ALTMSYLNGAAAMYEQRYAAEEGIDAAMTLGCGVPLGPLAQLDAMGLDTAHDTLEALYQR
TGDRGYAPAPVLTHMVAAGLLGVKSGRGFHDYAGGRAAGDARTGAQAAVPRTVRTIGVVG
SGVMATGIAEVCARSGHPTTLVARSGVKAKEALAAVGRSLERQVRRGRRTPEELAATTAR
LSGASAYEALADCDLVVEAVAEDLAVKRGVFGALDRVCRPGAVLATSTSSLPVVECATAT
GRPQDVLGMHFFNPAPVMKLVEVVRTVLTAQDTVSTALAAAAALGKRPVQCADRAGFIVN
ALLFPYLNRAVCMMREGVATADEIDTVMTAGHGFPMGPFKLLDVIGLDVSLAIQKTLHRA
FREPALAPARPLEQLVEAGYLGRKAGRGFRSYDTV
selected fasta
>putative 3-hydroxyacyl-CoA dehydrogenase [putative 3-hydroxybutyryl-CoA dehydrogenase]
ATGGGCATGGCACAGCAGCGTTTCCCGACGGTTGCGGTCGTCGGGCTCGGCATAACGGGT
TCCGCCCTCATGACATTACTGGCCCGTACCGGACACCGGGTGGTCGCGGTCGACGTGGAC
GAGGCGGCTCTGGAGCGCGCCCGGGACCGGGCTCGCGCGGCGGGAGTGGAGGGTGTCGAC
TTCACCACGCGGTTCGCCGACGTCGCCCGGGCCGATCTTCTCGTCGAGGCGGTGCCCGAA
CAGCTGGAGGCCAAGCGGCAGGTCCTGCGCCGCGCCCACGAAGTGTGCCCGGGCGCCACC
GTGTTCGCGACCACCACGACGTCCCTGTCGGTGACCGGTCTCGCCTTCGAGTCCGGGCGG
ATGGCGAGCACGATCGGCCTGCACTTCTTTCCCACGGCCCCTGAAAACGGCCTCGGAGCC
GTGGAGTTGATCGCCACCCCGGTCACGGCCCGGGCGTTGCTGGACGACGTCCGCGAGCTG
CTGCACGGCCTCGGCAGCACCGCCGTGTCCAGCACCGACAGCCCCGGTTTCGTCGGCGGC
GCCCTGACGATGTCGTACCTGAACGGCGCCGCCGCCATGTACGAGCAGCGCTACGCCGCC
GAGGAGGGCATCGACGCCGCGATGACCCTGGGCTGCGGCGTGCCCCTCGGCCCGCTCGCG
CAGCTCGACGCGATGGGCCTGGACACCGCCCACGACACCCTGGAAGCGCTCTACCAGCGC
ACCGGGGACCGCGGTTACGCCCCGGCCCCCGTGCTGACGCACATGGTGGCCGCCGGGCTG
CTCGGCGTGAAGTCGGGGCGCGGCTTCCACGACTACGCGGGCGGACGGGCGGCCGGCGAC
GCCCGCACAGGAGCGCAGGCGGCCGTGCCGCGCACCGTCCGCACCATCGGCGTGGTCGGC
TCCGGCGTCATGGCCACCGGCATCGCCGAGGTGTGCGCGCGCTCCGGACACCCCACCACG
CTGGTCGCCCGCAGCGGGGTGAAGGCGAAGGAGGCCCTGGCCGCGGTCGGGCGCTCACTG
GAGCGGCAGGTCCGCCGCGGCAGGCGGACCCCCGAGGAACTCGCCGCGACCACCGCCCGG
CTCAGCGGCGCGTCGGCCTACGAGGCGCTTGCCGACTGCGACCTCGTGGTGGAGGCCGTC
GCCGAGGACCTCGCGGTCAAACGGGGGGTGTTCGGCGCACTGGACCGGGTGTGCCGGCCC
GGCGCCGTGCTCGCCACCTCCACCTCCAGCCTGCCCGTCGTCGAATGCGCCACGGCCACC
GGTCGCCCGCAGGACGTGCTGGGCATGCACTTCTTCAACCCGGCACCGGTCATGAAGCTC
GTGGAGGTCGTACGGACGGTGCTGACCGCCCAGGACACGGTGTCCACCGCCCTCGCGGCC
GCCGCCGCCCTCGGCAAGCGGCCCGTCCAGTGCGCGGACCGGGCCGGCTTCATCGTGAAC
GCCCTGCTCTTCCCTTACCTCAACCGGGCGGTGTGCATGATGCGCGAGGGGGTGGCCACC
GCCGACGAGATCGACACGGTGATGACGGCCGGCCACGGCTTCCCGATGGGCCCCTTCAAG
CTGCTGGACGTGATCGGCCTCGACGTCTCACTGGCCATCCAGAAGACCCTGCACCGCGCG
TTCCGCGAGCCGGCGCTCGCCCCTGCCCGCCCGCTGGAACAGCTGGTGGAGGCGGGTTAC
TTGGGACGCAAGGCGGGACGCGGCTTCCGCTCGTACGACACCGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006108 3-hydroxyacyl-CoA dehydrogenase, C-terminal (Domain)
 [176-272]  5.30000000000001e-23 PF00725 [476-572]  1.4e-29 PF00725
PF00725   3HCDH
IPR006176 3-hydroxyacyl-CoA dehydrogenase, NAD binding (Domain)
 [10-173]  6.29999999999998e-33 PF02737 [295-473]  5.19999999999996e-57 PF02737
PF02737   3HCDH_N
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like (Domain)
 [175-276]  4.09999599045784e-25 SSF48179 [476-573]  1.29999924468179e-29 SSF48179
SSF48179   6DGDH_C_like
IPR013328 Dehydrogenase, multihelical (Domain)
 [178-272]  5.40000000000002e-56 G3DSA:1.10.1040.10 [478-572]  5.40000000000002e-56 G3DSA:1.10.1040.10
G3DSA:1.10.1040.10   Opine_DH
IPR016040 NAD(P)-binding domain (Domain)
 [8-177]  5.20000000000001e-81 G3DSA:3.40.50.720 [290-477]  5.20000000000001e-81 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-36]  0.689 Signal
Eukaryota   
 [1-36]  0.862 Signal
Bacteria, Gram-positive   
 [1-36]  0.329 Signal
Bacteria, Gram-negative   
TMHMM No significant hit