close all open/close all

CDS information : Lasal_00150


close this sectionLocation

Organism
StrainATCC 35851
Entry nameLasalocid
Contig
Start / Stop / Direction46,297 / 49,638 / + [in whole cluster]
46,297 / 49,638 / + [in contig]
Location46297..49638 [in whole cluster]
46297..49638 [in contig]
TypeCDS
Length3,342 bp (1,113 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)putative polyketide synthase
Gene
Gene (GenBank)lsd13
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19129623] Identification of a gene cluster of polyether antibiotic lasalocid from Streptomyces lasaliensis. (Biosci Biotechnol Biochem. , 2009)
Related Reference
ACC
B5M9L0
NITE
Lasal2_00180
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)

close this sectionPKS/NRPS Module

6 methylmalonyl-CoA
KS40..416
AT568..887
ACP959..1029

close this sectionSequence

selected fasta
>polyketide synthase [putative polyketide synthase]
MEVSRMPNTEEKLLDYLKRVTADLKQTQRRLREAEAADTEPIAIVGMGCRYPGDVRSADD
LWGLLAEGGDAISKFPDDRGWNTEELYDPDPDRPGRNYVREGGFLHDATEFDADFFGISP
REALAMDPQQRIMLEVAWETFEHAGLDPQSFGGSDTGVFVGISNVDYTWGHARVPEAVEG
YFGTGNFASVLSGRLAYTFGLEGPALTVDTACSSSLVALHLATQALRRGECGAALVGGVT
VMSNPSGFVEFSRQRGLAPDGRCKAFAAAADGFGPSEGAGVLLVERLSDARRNGHRVLAV
VRGSAVNQDGASNGLSAPNGPSQQRVIRQALRNARLSPEQVDAVEAHGTGTTLGDPIEAQ
ALLATYGQGRPEDRPLWLGSVKSNIGHTSAAAGVAGVIKMVMAMRHGVLPRSLHIDEPTP
QVDWSSGAVTLLTEPVDWPDSDRPRRAGVSAFGISGTNAHVILEQAPTQDPQQPAPPVPA
APWLLSAKTPAALRAQARRLHTHLTRHPHPDPTDIAHALATTRTPHEHRAALVTDDHGTL
LHGLLALGEESVAPYVVEPGRAVAGKTVFVFPGQGSQWTGMGRELLDTSEQFAAYIAECE
TALNDFVDWSLTDVLRGTEGAPGYDRVDVVQPALFAVMVSLARLWQHHGIHPDAVIGHSQ
GEIAAAHIAGALTLNDAARIVALRSQALLPLAGLGGMTSLALPHHQAHELIQPWGQDLSI
ASVNGPHSTVVSGTTHALDELHTTCNTQGVRARRIPVDYASHSAQVESIRDTVLQAATGI
NPQPTTIPLYSTVTGQPIDGTQLDADYWYTNLRHTVRFEETTRALLGSGHRHFIETTAHP
VLALALEETIEATGSDARVTGTLRRDHGDLTQLHTALATAWTHGVDVDWTAVVPGAGRRR
VDLPTYAFQRRRYWLEPGVVPVSDTVPVAVVDEAESGEAATALARALADASEAGREALLI
DLVQSRVAAVLGHEEPESVDTERAFKDLGFDSLTATQLRNRLNAATGLRLPATLVFSHPT
PKALAQYLAGVIRPDEEAAARPPALRDIDLLEDSLWAQSFDAATRDLVARRLDALLRRWS
AGGTTEEGVDEAALDTASDDELFQILDEQLGNA
selected fasta
>polyketide synthase [putative polyketide synthase]
ATGGAGGTGTCACGGATGCCGAACACGGAAGAGAAACTCCTCGACTACCTGAAGCGGGTC
ACCGCCGACCTCAAGCAGACGCAGCGACGCCTGCGTGAGGCCGAGGCCGCGGACACGGAG
CCGATCGCGATCGTCGGCATGGGCTGCCGCTACCCGGGCGACGTACGGTCCGCCGACGAC
CTGTGGGGGCTGCTGGCCGAGGGCGGCGACGCGATCTCGAAGTTCCCCGACGACCGAGGC
TGGAACACCGAGGAGCTCTACGACCCCGACCCCGACCGCCCCGGCCGCAACTACGTGCGA
GAGGGCGGCTTCCTGCACGACGCGACGGAGTTCGACGCCGACTTCTTCGGCATCTCCCCG
CGTGAGGCACTCGCCATGGATCCGCAGCAGCGCATCATGCTGGAGGTCGCCTGGGAGACG
TTCGAGCACGCGGGCCTGGACCCCCAGTCGTTCGGCGGCAGCGACACCGGCGTGTTCGTC
GGCATCAGCAACGTCGACTACACGTGGGGTCACGCCCGCGTCCCCGAGGCCGTCGAGGGG
TACTTCGGCACGGGCAACTTCGCCAGCGTGCTGTCCGGCCGGCTGGCCTACACGTTCGGG
CTGGAAGGCCCTGCGCTCACCGTCGACACGGCCTGCTCATCGTCGCTCGTGGCCCTGCAC
CTGGCGACGCAGGCCCTGCGCCGGGGCGAGTGCGGGGCAGCCCTGGTGGGCGGGGTCACC
GTGATGTCGAACCCGTCCGGCTTCGTGGAGTTCAGCCGCCAGCGGGGGCTCGCTCCGGAC
GGCCGCTGCAAGGCGTTCGCCGCGGCCGCCGACGGGTTCGGGCCGTCCGAGGGCGCGGGC
GTGCTGCTCGTGGAGCGCCTGTCCGACGCCCGCCGCAACGGTCACCGGGTACTGGCCGTC
GTCCGCGGCTCCGCCGTCAACCAGGACGGCGCCAGCAACGGCCTCTCCGCCCCCAACGGC
CCCTCCCAGCAGCGCGTGATCCGCCAGGCGCTCCGCAACGCACGGCTGTCACCGGAACAG
GTCGACGCCGTCGAGGCGCACGGCACGGGCACCACCCTGGGTGACCCGATCGAGGCGCAG
GCCCTGCTGGCCACCTACGGTCAGGGGCGTCCCGAGGACCGTCCGCTGTGGCTGGGCTCG
GTGAAGTCGAACATCGGGCACACGTCGGCCGCCGCCGGTGTGGCCGGGGTGATCAAGATG
GTGATGGCGATGCGGCACGGCGTCCTGCCCCGCAGCCTCCACATCGACGAGCCGACCCCG
CAGGTCGACTGGTCCTCCGGCGCCGTCACCCTGCTCACCGAACCCGTCGACTGGCCCGAC
TCCGACCGCCCCCGCCGCGCAGGCGTCTCCGCCTTCGGCATCAGCGGCACCAACGCCCAC
GTCATCCTCGAACAAGCCCCCACCCAAGACCCCCAGCAACCCGCCCCACCCGTACCCGCC
GCACCCTGGCTGCTCTCCGCCAAGACCCCGGCAGCACTGCGAGCCCAGGCCCGACGCCTG
CACACCCACCTCACCCGCCACCCCCACCCCGACCCCACCGACATCGCCCACGCCCTCGCC
ACCACCCGCACCCCCCACGAACACCGCGCCGCACTCGTCACCGACGACCACGGGACTTTG
TTACACGGACTGCTCGCGCTCGGGGAGGAGTCGGTAGCACCGTACGTGGTGGAGCCGGGC
AGAGCGGTAGCGGGAAAGACGGTGTTCGTGTTCCCGGGTCAGGGTTCGCAGTGGACCGGC
ATGGGACGCGAACTCCTCGACACCTCGGAGCAGTTCGCCGCCTACATCGCCGAGTGCGAG
ACCGCGCTCAACGACTTCGTGGACTGGTCGCTCACCGACGTCCTGCGCGGCACCGAAGGA
GCCCCCGGCTACGACCGCGTCGACGTCGTCCAACCCGCCCTCTTCGCCGTCATGGTCAGC
CTCGCCCGCCTCTGGCAACACCACGGCATCCACCCCGACGCCGTCATCGGCCACTCCCAA
GGCGAAATCGCCGCCGCCCACATCGCCGGAGCCCTCACCCTCAACGACGCCGCCCGCATC
GTCGCCCTACGCTCCCAAGCCCTCCTCCCCCTCGCCGGCCTCGGCGGCATGACCTCCCTC
GCCCTCCCCCACCACCAAGCCCACGAACTCATCCAGCCCTGGGGCCAAGACCTGTCCATC
GCCTCCGTCAACGGACCCCACTCCACCGTCGTCTCCGGCACCACCCACGCCCTCGACGAA
CTACACACCACCTGCAACACCCAAGGAGTTCGGGCCCGCCGCATCCCCGTCGACTACGCC
TCCCACTCCGCCCAAGTCGAAAGCATCCGCGACACCGTCCTCCAAGCAGCCACCGGCATC
AACCCCCAGCCCACCACCATCCCCCTCTACTCCACCGTCACCGGCCAACCCATCGACGGC
ACCCAGCTCGACGCCGACTACTGGTACACCAACCTCCGCCACACCGTCCGCTTCGAAGAA
ACCACCCGCGCTCTGCTCGGCTCCGGCCACCGCCACTTCATCGAAACCACCGCCCACCCC
GTCCTCGCCCTCGCCCTGGAAGAAACCATCGAGGCCACCGGCTCCGACGCCCGCGTCACC
GGCACCCTCCGCCGCGACCACGGCGACCTCACCCAACTCCACACCGCCCTCGCCACCGCC
TGGACCCACGGCGTCGACGTCGACTGGACCGCAGTGGTGCCCGGTGCGGGCAGGAGGCGG
GTGGACCTGCCGACGTACGCCTTCCAGCGTCGGCGTTACTGGCTCGAGCCGGGTGTCGTG
CCGGTGAGCGACACCGTCCCGGTGGCCGTGGTGGACGAAGCGGAGAGCGGGGAGGCGGCC
ACCGCGCTCGCACGCGCCCTGGCGGATGCCTCGGAGGCGGGCCGGGAGGCTCTGCTGATC
GACCTCGTACAGTCTCGCGTGGCCGCCGTGCTCGGTCACGAGGAGCCGGAGTCGGTCGAC
ACCGAGCGGGCCTTCAAGGACCTGGGCTTCGACTCGCTCACCGCGACGCAGTTGCGCAAC
CGGCTGAACGCGGCCACGGGGCTGCGCCTGCCGGCCACGCTCGTCTTCAGCCATCCGACT
CCCAAGGCGCTGGCCCAGTACCTGGCCGGCGTCATACGGCCCGACGAGGAGGCCGCCGCC
CGGCCGCCCGCCCTGCGGGACATCGATCTGCTGGAGGACAGCCTGTGGGCGCAGTCCTTC
GACGCCGCGACCCGTGACCTCGTCGCCCGGCGGCTCGACGCGCTCCTGCGCCGGTGGAGT
GCGGGCGGGACCACCGAGGAGGGCGTCGACGAGGCCGCCCTCGACACCGCCTCCGACGAC
GAGCTCTTCCAGATCCTCGACGAACAGCTGGGCAACGCCTGA
[6] KS40..416
[6] AT568..887
[6] methylmalonyl-CoA759..763
[6] ACP959..1029
[6] KS118..1248
[6] AT1702..2661
[6] methylmalonyl-CoA2275..2289
[6] ACP2875..3087

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [562-691]  1.10000000000001e-74 G3DSA:3.40.366.10 [759-876]  1.10000000000001e-74 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [987-1002]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [963-1028]  2e-14 PF00550
PF00550   PP-binding
 [959-1029]  PS50075
PS50075   ACP_DOMAIN
 [959-1031]  1.4e-23 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [951-1046]  4.00000300869883e-23 SSF47336
SSF47336   ACP_like
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [40-290]  3.70000000000004e-97 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [298-416]  5.10000000000004e-50 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [568-887]  5.40000000000002e-106 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [9-33]  6.2e-13 PF08990
PF08990   Docking
 [9-40]  1.79999951654677e-06 SSF101173
SSF101173   Polyketide_synth_docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [566-870]  2.7000136937899e-66 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [693-758]  3.29999802154459e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [40-301]  2.30000000000004e-93 G3DSA:3.40.47.10 [302-469]  4.2e-67 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [32-414]  7.90003079443025e-107 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [203-219]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [570-867]  3.60002015031011e-122 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [960-1032]  8.30001403791595e-36 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [42-468]  SM00825
SM00825   PKS_KS
SignalP No significant hit
TMHMM No significant hit