close all open/close all

CDS information : Lasal_00200


close this sectionLocation

Organism
StrainATCC 35851
Entry nameLasalocid
Contig
Start / Stop / Direction76,196 / 77,614 / + [in whole cluster]
76,196 / 77,614 / + [in contig]
Location76196..77614 [in whole cluster]
76196..77614 [in contig]
TypeCDS
Length1,419 bp (472 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productepoxidase
Product (GenBank)putative epoxidase
Gene
Gene (GenBank)lsd18
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19129623] Identification of a gene cluster of polyether antibiotic lasalocid from Streptomyces lasaliensis. (Biosci Biotechnol Biochem. , 2009)
[22506807] Sequential enzymatic epoxidation involved in polyether lasalocid biosynthesis. (J Am Chem Soc. , 2012)
[23796908] Biosynthetic machinery of ionophore polyether lasalocid: enzymatic construction of polyether skeleton. (Curr Opin Chem Biol. , 2013)
Related Reference
ACC
B5M9L6
NITE
Lasal2_00240
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)
[22025396] Insights into lasalocid A ring formation by chemical chain termination in vivo. (Angew Chem Int Ed Engl. , 2011)
ACC
Q846W9
NITE
Monen_00220
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)

close this sectionSequence

selected fasta
>epoxidase [putative epoxidase]
MTNTRSAVVLGGGMAGMLVSSMLARHVGSVTVIDRDAFPAGPDLRKGVPQARHAHILWSG
GARIVEELLPGTTDRLLGAGAHRIGIPDGQVSYTAYGWQHRFPEAQFMIACSRALLDWTV
REETLREERIALVEKTEVLALLGDAGRVTGVRVRDQESGEEREVPADLVVDTTGRGSPSK
RLLAELGLPAPEEEFVDSGMVYATRLFRAPEAAATNFPLVSVHADHRAGRPGCNAVLMPI
EDGRWIVTVSGTRGGEPPADDEGFARFARDGVRHPLVGELIAKAQPLTSVERSRSTVNRR
LHYDRLATWPEGLVVLGDAVAAFNPVYGHGMSAAAHSVLALRSQLGQRAFQPGLARAAQR
AIAVAVDDAWVLATSHDIGYPGCRTQTRDPRLTRHAGERQRVTDLVGLTATRNQVVNRAA
VALNTLSAGMASMQDPAVMAAVRRGPEVPAPTEPPLRPDEVARLVSGAGVTA
selected fasta
>epoxidase [putative epoxidase]
ATGACCAATACCCGGAGCGCCGTTGTTTTGGGCGGCGGTATGGCCGGAATGCTCGTCTCC
TCGATGCTGGCCCGTCACGTCGGCTCGGTGACCGTGATCGACCGGGACGCGTTCCCGGCG
GGTCCGGACCTGCGCAAGGGGGTTCCGCAGGCCCGGCACGCCCACATCCTCTGGTCGGGC
GGCGCCCGGATCGTCGAGGAGCTGCTGCCCGGGACCACGGACCGGCTGCTGGGTGCCGGC
GCGCACCGTATCGGCATCCCCGACGGGCAGGTGTCGTACACCGCCTACGGGTGGCAACAT
CGTTTCCCGGAGGCCCAGTTCATGATCGCCTGCAGTCGTGCGCTGCTGGACTGGACGGTG
CGCGAGGAGACCCTGCGGGAGGAGCGCATCGCCCTGGTCGAGAAGACGGAGGTGCTGGCG
CTGCTGGGTGACGCGGGCCGGGTCACGGGGGTACGGGTGCGGGACCAGGAGTCCGGCGAG
GAGCGGGAGGTGCCGGCCGATCTCGTGGTCGACACCACCGGCCGGGGGTCACCGTCGAAG
CGGCTGCTGGCGGAGCTGGGATTGCCGGCACCCGAGGAGGAGTTCGTCGACTCGGGGATG
GTGTACGCGACGCGGCTCTTCCGGGCGCCCGAGGCGGCTGCGACGAACTTCCCGCTGGTG
AGCGTGCACGCCGACCACCGTGCGGGCCGGCCGGGCTGCAACGCGGTGCTGATGCCGATC
GAGGACGGCCGCTGGATCGTCACGGTCTCCGGGACACGCGGGGGTGAACCGCCCGCCGAC
GACGAGGGGTTCGCACGGTTCGCTCGGGACGGCGTCCGCCATCCGCTGGTCGGCGAACTC
ATCGCCAAGGCGCAGCCGCTCACTTCGGTGGAGCGGTCCCGCTCGACGGTCAACCGCCGG
CTGCATTACGACCGGTTGGCCACCTGGCCGGAGGGCCTGGTGGTGCTGGGCGACGCCGTG
GCCGCCTTCAACCCCGTGTACGGGCACGGGATGAGCGCGGCGGCGCACAGTGTGCTGGCA
CTCCGGTCCCAGCTCGGGCAGCGCGCCTTCCAGCCCGGTCTGGCGCGCGCGGCGCAGCGG
GCGATCGCCGTGGCGGTGGACGACGCCTGGGTGCTGGCCACCTCGCACGACATCGGCTAC
CCGGGGTGCCGGACCCAGACCAGGGACCCGCGGCTGACCCGCCACGCCGGGGAACGGCAG
CGCGTCACCGACCTGGTGGGACTCACCGCGACCCGCAACCAGGTGGTCAACCGGGCCGCC
GTGGCCCTCAACACCCTGTCGGCGGGCATGGCGAGCATGCAGGACCCCGCGGTCATGGCG
GCGGTCCGGCGCGGCCCCGAGGTGCCGGCGCCGACCGAACCGCCGTTGCGGCCCGACGAG
GTCGCCCGGCTGGTGTCCGGCGCCGGTGTGACGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [7-346]  3.60000000000001e-09 PF01494
PF01494   FAD_binding_3
SignalP
 [1-27]  0.941 Signal
Bacteria, Gram-negative   
 [1-29]  0.972 Signal
Bacteria, Gram-positive   
 [1-24]  0.903 Signal
Eukaryota   
TMHMM
 [7-29]  Transmembrane (i-o)
Transmembrane 1