close all open/close all

CDS information : Lasal_00230


close this sectionLocation

Organism
StrainATCC 35851
Entry nameLasalocid
Contig
Start / Stop / Direction80,186 / 80,605 / + [in whole cluster]
80,186 / 80,605 / + [in contig]
Location80186..80605 [in whole cluster]
80186..80605 [in contig]
TypeCDS
Length420 bp (139 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • orf4
Reference
ACC

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MPTTSTPALRAVTVTRTSSGTSTVGMRGHGRPSRSCSSQERSSTSMSSWCDQCAPTSPST
ETLRPSAGRSLTPLSVVMTTVLPESTAPSIPSARGPPEPPSPPWQATARGSTARATVRRR
RRVPGFAVMHPAFPGSAPP
selected fasta
>hypothetical protein [hypothetical protein]
ATGCCGACGACGTCGACGCCCGCGTTGCGTGCGGTGACCGTGACGCGTACGTCGTCCGGA
ACCTCCACCGTGGGCATGCGTGGGCACGGGCGGCCCTCGCGGTCCTGTTCGTCGCAGGAG
AGGTCCAGCACCTCCATGTCGTCGTGGTGCGACCAGTGCGCGCCGACATCGCCGTCGACG
GAGACGCTCCGTCCGTCGGCGGGGCGCAGCCTGACCCCGTTGTCGGTGGTGATGACGACC
GTGCTGCCGGAGTCCACGGCGCCGAGCATCCCGTCGGCCCGCGGGCCTCCGGAGCCACCG
TCCCCGCCGTGGCAGGCCACGGCCAGGGGCAGCACAGCCAGGGCAACGGTCAGACGGCGC
AGGCGAGTTCCGGGGTTCGCAGTCATGCACCCCGCTTTCCCCGGCTCAGCCCCACCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-11]  0.565 Signal
Bacteria, Gram-negative   
 [1-26]  0.54 Signal
Bacteria, Gram-positive   
TMHMM No significant hit