close all open/close all
Lasal_00230 Lasal_00230   last last

CDS information : Lasal_00240


close this sectionLocation

Organism
StrainATCC 35851
Entry nameLasalocid
Contig
Start / Stop / Direction80,651 / 81,376 / + [in whole cluster]
80,651 / 81,376 / + [in contig]
Location80651..81376 [in whole cluster]
80651..81376 [in contig]
TypeCDS
Length726 bp (241 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • orf5
Reference
ACC
Related Reference
ACC
B5M9M0
NITE
Lasal2_00280
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MNPDLYPDLVAAGGLGAALEQLAAGLGVEFTVVPQEGRTSRSAGIASSVRERGPLSVHIA
AEERFFLVSGWSEGIESVTGGTPDPAEVVLAGAAWGQGTPLRELEARFPFLRVGERAKAA
EHGPAAVVALQWRTLRRRAAGAPDVPGFGDLVTAAHAEPRLRQLYVFSSHWTLGFSSCTG
YPFRTEVAIAPALGGSPYRVMQRPHRTAIGEAATAGEAVAFAASRLPAGLGPAVAGTAED
G
selected fasta
>hypothetical protein [hypothetical protein]
ATGAACCCCGATCTCTACCCCGACCTGGTCGCCGCGGGAGGCCTGGGCGCGGCGCTGGAA
CAGCTGGCGGCCGGCCTCGGTGTCGAGTTCACCGTCGTCCCGCAGGAAGGGCGCACGTCC
CGGTCGGCGGGGATCGCCTCGTCGGTCCGCGAACGAGGTCCGCTGTCGGTCCACATCGCG
GCCGAGGAGCGCTTCTTCCTCGTCTCGGGCTGGAGTGAAGGCATCGAGAGCGTCACCGGA
GGCACGCCCGATCCGGCGGAGGTGGTCCTGGCCGGTGCGGCATGGGGACAGGGCACTCCA
CTACGGGAGTTGGAGGCCCGGTTCCCCTTCCTGCGCGTCGGTGAGCGTGCGAAGGCCGCC
GAGCACGGACCGGCCGCGGTGGTCGCGTTGCAGTGGCGAACGCTGCGGAGACGGGCGGCC
GGCGCACCGGACGTCCCCGGGTTCGGCGACCTCGTGACAGCGGCCCACGCCGAACCACGG
TTGAGACAGCTGTACGTGTTCTCCAGCCACTGGACGCTCGGCTTCAGCTCGTGCACCGGA
TACCCGTTCCGCACCGAGGTGGCCATCGCTCCAGCGCTCGGCGGGAGCCCGTACCGCGTG
ATGCAGCGCCCGCACCGGACGGCGATCGGTGAGGCCGCCACGGCCGGGGAAGCCGTCGCG
TTCGCGGCGTCCCGGCTGCCCGCGGGCCTGGGGCCGGCTGTCGCGGGAACGGCTGAGGAC
GGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit
Lasal_00230 Lasal_00230   last last