close all open/close all
first first   Lydi_00020 Lydi_00020

CDS information : Lydi_00010


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction1,413 / 1 / - [in whole cluster]
1,413 / 1 / - [in contig]
Locationcomplement(1..1413) [in whole cluster]
complement(1..1413) [in contig]
TypeCDS
Length1,413 bp (470 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative carboxylic acid--CoA ligase
putative acyl-CoA synthetase
Product (GenBank)acyl-CoA synthetase
GeneTPA0598_03_00650
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)
Related Reference
ACC
Q52V65
PmId
[15844935] Microbial genomics as a guide to drug discovery and structural elucidation: ECO-02301, a novel antifungal agent, as an example. (J Nat Prod. , 2005)
ACC
Q52V67
PmId
[15844935] Microbial genomics as a guide to drug discovery and structural elucidation: ECO-02301, a novel antifungal agent, as an example. (J Nat Prod. , 2005)
[20394362] A three enzyme pathway for 2-amino-3-hydroxycyclopent-2-enone formation and incorporation in natural product biosynthesis. (J Am Chem Soc. , 2010)
Family/Domain
FD
IPR000873

close this sectionSequence

selected fasta
>putative carboxylic acid--CoA ligase [acyl-CoA synthetase]
MNAKIFAPDSVRTLSEFEHDALRIAQVLGERGVGPGDRVMLKAGNSPAWVATLLGLMHIG
ASIVLVDQQEHAEPTRRIILRTGTKLVLSDEDSPLDSSQEAVHLYELLVSAAGRQVADER
LTVDTWCELPDGLIMWTSGSTGTPKGVVKSGRKFLKNLERNAAQVGHREDDVLLPLLPFA
HQYGLSMVLIAWLKRCSLVIAPYRRLDRALRMAEESGVTVIDATPSSYRSMLNLASRKPS
LRPGLARARMFCVGAAPLDDPLVGQYEAEFGRPLLDSYGSTELGNIAFATPDNPVACGQA
MDGIQVRVVDDEGRTVPTGEPGEVEVNTPDALEGYLAEDGTLQPAPQGWQRTGDLGRLDA
DGNLIVLGRKYAVHRKGYTLYPELIERSVASQGCSVRIVALPDERRGAQLVFFVEDDEGQ
EDAYWRERLCGMLAAYEHPDRVVVLEHFPLNRNGKPDKRQLEHLARARGR
selected fasta
>putative carboxylic acid--CoA ligase [acyl-CoA synthetase]
GTGAACGCAAAGATCTTTGCCCCTGACTCGGTGCGGACCCTGTCCGAATTCGAGCACGAC
GCACTCCGCATCGCGCAGGTGCTCGGCGAGCGGGGCGTCGGCCCCGGGGACCGGGTCATG
CTCAAGGCCGGCAACTCGCCCGCCTGGGTGGCCACGCTGCTCGGGCTGATGCACATAGGC
GCCTCGATCGTGCTGGTCGACCAGCAGGAGCATGCGGAGCCGACGCGCAGGATCATCCTG
CGGACCGGTACCAAGCTGGTCCTCAGTGACGAGGACTCGCCGCTCGACAGCAGCCAGGAG
GCCGTGCACCTCTACGAGTTGCTGGTGTCCGCCGCCGGCCGGCAGGTCGCGGACGAGCGG
CTGACCGTCGACACCTGGTGCGAGCTCCCCGACGGCCTGATCATGTGGACCTCCGGCTCG
ACCGGCACCCCCAAGGGCGTGGTCAAGTCCGGCCGCAAGTTCCTGAAGAACCTCGAACGG
AACGCCGCGCAGGTCGGGCACCGGGAGGACGACGTCCTGCTGCCGCTGCTGCCGTTCGCC
CACCAGTACGGCCTCTCCATGGTGCTGATCGCCTGGCTGAAACGGTGCTCGCTGGTGATC
GCCCCGTACCGGCGGCTGGACCGCGCGCTGCGGATGGCGGAGGAGTCGGGGGTCACGGTC
ATCGACGCCACGCCCTCCAGCTACCGCAGCATGCTCAACCTCGCCTCGCGGAAGCCGAGT
CTGCGCCCCGGGCTGGCGCGGGCGCGGATGTTCTGCGTCGGCGCGGCGCCGCTGGACGAT
CCGCTGGTCGGCCAGTACGAGGCGGAGTTCGGGCGGCCGCTGCTGGACAGCTACGGCAGC
ACGGAGCTGGGCAATATCGCCTTCGCGACACCGGACAACCCGGTGGCGTGCGGGCAGGCG
ATGGACGGTATCCAGGTGCGCGTCGTCGACGACGAGGGGCGGACGGTCCCCACGGGCGAG
CCCGGCGAGGTAGAGGTGAACACCCCTGACGCACTGGAGGGGTATCTCGCCGAGGACGGC
ACCCTCCAGCCCGCCCCCCAGGGCTGGCAGCGCACCGGCGATCTGGGCCGGCTCGACGCG
GACGGCAATCTCATCGTCCTCGGCCGCAAGTACGCGGTGCACCGCAAGGGTTACACCCTC
TACCCCGAACTGATCGAACGCAGCGTGGCGTCGCAGGGCTGCTCCGTCAGGATCGTCGCC
CTGCCCGACGAGCGGCGTGGCGCCCAGCTCGTCTTCTTCGTGGAGGACGACGAGGGCCAG
GAGGACGCGTACTGGCGCGAGCGGCTCTGTGGCATGCTGGCGGCCTACGAGCACCCCGAC
CGGGTCGTCGTGCTCGAACACTTCCCGCTCAACCGCAACGGCAAGCCGGACAAACGGCAG
TTGGAGCATCTCGCCCGAGCCCGCGGCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [13-390]  9.8e-63 PF00501
PF00501   AMP-binding
IPR020845 AMP-binding, conserved site (Conserved_site)
 [134-145]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit
first first   Lydi_00020 Lydi_00020