close all open/close all

CDS information : Lydi_00020


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction3,223 / 6,012 / + [in whole cluster]
3,223 / 6,012 / + [in contig]
Location3223..6012 [in whole cluster]
3223..6012 [in contig]
TypeCDS
Length2,790 bp (929 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)putative LuxR family transcriptional regulator
GeneTPA0598_03_00660
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)
Related Reference
ACC
Q9ZGI0
NITE
Pikro_00180
PmId
[11344155] Characterization and analysis of the PikD regulatory factor in the pikromycin biosynthetic pathway of Streptomyces venezuelae. (J Bacteriol. , 2001)
[18245260] Enhanced heterologous production of desosaminyl macrolides and their hydroxylated derivatives by overexpression of the pikD regulatory gene in Streptomyces venezuelae. (Appl Environ Microbiol. , 2008)
[26608164] Interspecies Complementation of the LuxR Family Pathway-Specific Regulator Involved in Macrolide Biosynthesis. (J Microbiol Biotechnol. , 2016)

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [putative LuxR family transcriptional regulator]
MGLVEREAVMSELRAALSDSAKGCGKVAVIRGGIASGKTALLRAFEEHAVAAGATLLRAS
GAPGEQSLRFGVIEQFLSGATTPPGATESLSHLAGLTTPQVGSEAPSSALSGTRAAHDLC
VGLLELSRQGPLVITVDDHQFADSASLQVLTYLQHRIGTARVMLLLSQGTEPPSELVAEV
LRQPYSRQFTLSPLSPEGVGQLLAQRLDSSVAVQQAPGSYAVTGGNPLLTHALIDDSLAP
DQEAAAGAAVEPVAGQAFTRAVLAILRRGGPQLLRTARAVAVLGEFAAPALLARFLDVRP
SVVGGALETLELAGLTTDAQFRYHGTRTAVLDELTPEERSALNRRAAELLHHDGVAPSDV
VGYLLAAGEADEPWAARVLHAAADQALAHAEQALAGGKVAEAVQYLEFASRSCGDEHKRA
MLTARLAWVQWTISPAAATRHHGPLQTALEKELLSSREVMRLVRSLAWHGRPEEAVRALQ
SLGSLPEGDGSRDPAERRLTRQWLARWYPQIFAQVERHAAMAEPMSSPGPVRRPHPAVLP
RGTANVPAVDGPEQVLQRARVRETPLASVLSALHELLAAERFERAMYWCNELLQKAEGQH
AAAWRGVLLDTRAAVSLRLGDLADAERDASSALTALSARSWGVAIGSPLSHAIHAATMRG
HFDRAEAFLHQMIPQSMMDTRYGLQYRTARGHFHLATDRPHAALEDFEAVGDLVVKWKLD
HPMTLPWRGDLAQALVRVGQTDRARELIKDQLRMIGPDSTRMRGISLGILASVSDLKQRL
PLLGEVVDLLQAGGDRYQLAQAFVELGQVWQILGKLDRAQLIRRRALQLAKSCHAEQLSH
QLLATREPLNSEPATSQWEDAEGMAVLSEAERRVAALAALGRTNREIGRKLHITVSTVEQ
HLTRVYRKLNIKRRADLPVGLPADIADIA
selected fasta
>putative LuxR family transcriptional regulator [putative LuxR family transcriptional regulator]
ATGGGGTTAGTGGAACGAGAAGCAGTGATGTCGGAGCTACGCGCCGCATTGAGCGACAGC
GCCAAAGGGTGCGGCAAGGTAGCGGTGATACGAGGGGGAATCGCCAGCGGTAAGACGGCC
CTGCTCAGGGCGTTCGAGGAGCATGCGGTGGCGGCCGGCGCCACGCTGTTGCGGGCCTCG
GGCGCGCCCGGTGAGCAATCGCTCCGCTTCGGTGTGATCGAGCAGTTCCTCAGCGGGGCG
ACCACCCCGCCGGGAGCCACCGAGTCGCTGTCCCACCTGGCCGGCCTGACCACGCCCCAG
GTGGGGAGCGAGGCGCCCTCTTCTGCGCTGTCCGGGACCAGGGCCGCGCACGACCTGTGC
GTCGGGCTGCTCGAACTGAGCAGGCAGGGGCCATTGGTGATCACCGTGGACGATCACCAG
TTCGCTGACAGCGCCTCGCTGCAAGTGCTGACCTACCTCCAGCACCGGATCGGCACCGCA
CGGGTGATGCTGCTGCTCAGCCAGGGGACCGAACCGCCGTCCGAGCTGGTCGCCGAGGTG
CTCAGGCAGCCGTACTCCCGGCAGTTCACGCTGTCCCCGCTGTCCCCGGAAGGGGTCGGG
CAGCTTCTCGCGCAGCGGCTGGACTCCTCGGTCGCCGTTCAGCAGGCACCCGGCAGTTAC
GCCGTGACCGGTGGCAATCCCCTGCTGACGCACGCCCTGATCGACGACAGTCTGGCCCCC
GACCAGGAAGCGGCCGCCGGAGCGGCGGTCGAACCGGTCGCCGGGCAGGCCTTCACCAGG
GCCGTGCTGGCGATCCTGCGTCGCGGCGGCCCGCAACTGCTGCGGACGGCGCGAGCGGTC
GCGGTGCTCGGCGAGTTCGCCGCCCCCGCGCTGCTGGCCCGATTCCTGGACGTCCGGCCG
TCGGTCGTGGGCGGTGCGCTGGAAACCCTGGAACTGGCGGGGCTGACCACCGACGCCCAG
TTCCGCTACCACGGCACACGGACCGCCGTACTGGACGAACTCACGCCCGAGGAGCGTTCC
GCACTGAACCGCCGCGCGGCCGAGCTGCTGCACCACGACGGCGTGGCACCCTCGGACGTG
GTGGGCTACCTGCTGGCCGCCGGCGAGGCCGACGAGCCCTGGGCCGCCCGGGTGCTGCAT
GCCGCCGCCGACCAGGCGCTGGCCCACGCGGAGCAGGCGCTGGCGGGCGGCAAGGTGGCG
GAGGCCGTGCAGTACCTGGAGTTCGCCAGCCGTTCCTGCGGCGACGAGCACAAGCGCGCC
ATGCTCACCGCCCGGCTCGCCTGGGTGCAGTGGACGATCAGCCCCGCGGCCGCGACCCGG
CACCACGGGCCCTTGCAGACGGCGCTGGAGAAGGAGTTGCTCAGCTCCCGTGAGGTGATG
CGGCTGGTCCGTTCGCTGGCATGGCACGGCCGCCCCGAGGAAGCGGTGCGCGCGCTGCAA
AGCCTGGGCTCCCTGCCCGAGGGCGACGGCTCCCGCGATCCGGCTGAACGGAGACTGACC
CGCCAGTGGCTCGCCCGCTGGTATCCGCAGATCTTCGCCCAGGTCGAACGGCACGCCGCG
ATGGCCGAACCCATGAGTTCCCCGGGCCCGGTGCGCCGGCCACACCCCGCCGTCCTTCCT
CGTGGCACCGCAAACGTCCCGGCCGTGGACGGACCCGAGCAGGTGCTGCAAAGGGCCCGG
GTCCGGGAGACCCCGCTGGCATCCGTGCTCTCCGCGCTCCATGAACTCCTCGCTGCCGAG
CGGTTCGAGCGCGCGATGTACTGGTGCAATGAGCTGCTCCAGAAGGCCGAGGGCCAGCAT
GCCGCCGCATGGCGCGGTGTGCTGCTGGACACCAGGGCCGCGGTCAGCCTCCGGCTCGGT
GATCTCGCCGATGCGGAACGGGACGCTTCCAGCGCTTTGACGGCCCTCTCCGCACGGAGC
TGGGGCGTGGCGATCGGTTCACCGCTGTCGCACGCGATACACGCCGCGACGATGCGCGGC
CACTTCGACCGGGCCGAGGCATTCCTCCACCAGATGATCCCGCAGTCCATGATGGACACC
CGTTACGGGCTCCAGTACCGGACGGCGCGGGGGCATTTCCATCTCGCGACGGACCGGCCG
CATGCCGCGCTGGAGGATTTCGAGGCCGTGGGCGATCTCGTGGTCAAGTGGAAGCTCGAT
CACCCGATGACGCTGCCCTGGCGCGGGGACCTGGCCCAGGCCCTGGTGCGGGTGGGGCAG
ACCGACCGGGCCAGGGAGCTCATCAAGGATCAACTACGCATGATCGGGCCGGACTCCACC
CGGATGCGCGGGATCTCCCTCGGCATCCTCGCCTCGGTCAGCGACCTCAAACAACGACTG
CCGCTGCTCGGCGAGGTGGTCGATCTGTTGCAGGCCGGCGGGGACCGCTACCAGCTGGCC
CAGGCGTTCGTCGAACTCGGTCAGGTCTGGCAGATCCTCGGCAAACTGGACCGGGCCCAG
CTGATCCGGCGCCGGGCGCTGCAACTCGCCAAGAGCTGCCATGCCGAGCAGTTGTCCCAT
CAGCTGCTCGCCACCAGGGAGCCGCTGAACAGTGAGCCGGCCACGAGCCAGTGGGAGGAC
GCCGAGGGCATGGCCGTGCTGAGCGAGGCCGAGCGCCGGGTGGCCGCGCTCGCCGCGCTG
GGGCGGACGAACCGGGAGATCGGCCGGAAGCTGCACATCACCGTGAGCACCGTGGAACAG
CACCTGACGAGGGTGTACCGGAAGCTGAACATCAAGCGCCGGGCGGATCTGCCGGTCGGG
CTCCCGGCGGATATCGCGGATATCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [864-921]  5.5e-17 SM00421
SM00421   helix_turn_helix, Lux Regulon
 [867-881]  2.1e-08 PR00038 [881-897]  2.1e-08 PR00038 [897-909]  2.1e-08 PR00038
PR00038   HTHLUXR
 [860-925]  15.773 PS50043
PS50043   HTH_LUXR_2
 [881-908]  PS00622
PS00622   HTH_LUXR_1
 [865-917]  2.3e-11 PF00196
PF00196   GerE
IPR011990 Tetratricopeptide-like helical (Domain)
 [731-839]  5.9e-08 G3DSA:1.25.40.10
G3DSA:1.25.40.10   no description
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [863-917]  2.1e-15 G3DSA:1.10.10.10
G3DSA:1.10.10.10   no description
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [845-917]  2.5e-15 SSF46894
SSF46894   C-terminal effector domain of the bipartite response regulators
SignalP No significant hit
TMHMM No significant hit